BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30504 (538 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_56768| Best HMM Match : VWA (HMM E-Value=0.0042) 31 0.45 SB_3342| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_34121| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 >SB_56768| Best HMM Match : VWA (HMM E-Value=0.0042) Length = 815 Score = 31.5 bits (68), Expect = 0.45 Identities = 12/42 (28%), Positives = 24/42 (57%) Frame = +2 Query: 2 FFYTNLTVAVSLKTNRMLCLVCLCSDISGFIMYLPA*RQRDV 127 FF T + + + ++ + CL D+ G+++Y P+ +RDV Sbjct: 650 FFQTMVKMYLGIRCKDITSTTCLLVDVGGYVVYHPSFAKRDV 691 >SB_3342| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 919 Score = 28.7 bits (61), Expect = 3.2 Identities = 13/43 (30%), Positives = 20/43 (46%) Frame = -2 Query: 141 CSSALTSRWR*AGRYMINPEISLHKQTRHNILFVFKETATVKF 13 C+S L W+ ++I PE LH N +F + T+ F Sbjct: 464 CTSILNFLWKKLSEFVIEPESKLHFIRFLNCALIFLTSITITF 506 >SB_34121| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 233 Score = 27.9 bits (59), Expect = 5.6 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +1 Query: 277 KKICAKTAAFATEAMMPHLDDRH 345 KK C + ++F E + HL DRH Sbjct: 76 KKNCTEVSSFLVELRLAHLSDRH 98 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,201,776 Number of Sequences: 59808 Number of extensions: 239038 Number of successful extensions: 412 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 370 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 412 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1215643300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -