BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30500 (564 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 129 2e-30 SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) 125 2e-29 SB_3221| Best HMM Match : rve (HMM E-Value=3) 29 2.0 SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.6 SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) 28 4.6 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_48401| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) 28 4.6 >SB_33031| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 143 Score = 129 bits (311), Expect = 2e-30 Identities = 58/65 (89%), Positives = 64/65 (98%) Frame = +2 Query: 254 KKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKEKK 433 KK+TAFVP DGCLN+IEENDEVL++GFGR+GHAVGDIPGVRFKVVKVANVSLLAL+KEKK Sbjct: 79 KKITAFVPNDGCLNYIEENDEVLISGFGRRGHAVGDIPGVRFKVVKVANVSLLALFKEKK 138 Query: 434 ERPRS 448 ERPRS Sbjct: 139 ERPRS 143 Score = 54.0 bits (124), Expect = 8e-08 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +3 Query: 177 EKVGVEAKQPNSAIRKCVRVQLIKNGRK 260 ++ GVEAKQPNSAIRKCVRVQLIKNG+K Sbjct: 53 QEPGVEAKQPNSAIRKCVRVQLIKNGKK 80 >SB_37381| Best HMM Match : Ribosomal_S12 (HMM E-Value=0) Length = 413 Score = 125 bits (302), Expect = 2e-29 Identities = 56/66 (84%), Positives = 62/66 (93%) Frame = +3 Query: 63 NHRREQRWADKEFKKAHMGTKWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQL 242 +HRR+Q+W DK +KKAH+GT KANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQL Sbjct: 14 SHRRDQKWHDKAYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQL 73 Query: 243 IKNGRK 260 IKNG+K Sbjct: 74 IKNGKK 79 Score = 82.2 bits (194), Expect = 3e-16 Identities = 33/40 (82%), Positives = 39/40 (97%) Frame = +2 Query: 254 KKVTAFVPRDGCLNHIEENDEVLVAGFGRKGHAVGDIPGV 373 KK+TAFVP DGCLN+IEENDEVL++GFGR+GHAVGDIPG+ Sbjct: 78 KKITAFVPNDGCLNYIEENDEVLISGFGRRGHAVGDIPGI 117 >SB_3221| Best HMM Match : rve (HMM E-Value=3) Length = 324 Score = 29.5 bits (63), Expect = 2.0 Identities = 23/70 (32%), Positives = 34/70 (48%) Frame = -1 Query: 471 SLITMYTYDLGRSFFSL*RARRDTLATFTTLKRTPGMSPTA*PLRPNPATSTSSFSSMWF 292 S T TYDL SF+S+ + + LAT +K++P + + L+P A S S Sbjct: 9 SFDTFPTYDLA-SFYSVLCSGDEQLATIKLMKKSPSLFQKSHTLKPR-ANCASIASETLA 66 Query: 291 RQPSRGTNAV 262 +Q R N V Sbjct: 67 QQCWRSLNTV 76 >SB_34124| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 468 Score = 29.1 bits (62), Expect = 2.6 Identities = 15/33 (45%), Positives = 18/33 (54%) Frame = +2 Query: 107 SPHGYEMEG*PFRWCISRKGHRPRESWCRS*AA 205 S HG MEG P W +S G P+ S C S +A Sbjct: 85 SQHGTRMEGVPVCWYVSVWGLSPQVSQCDSVSA 117 >SB_52986| Best HMM Match : zf-C2H2 (HMM E-Value=0.0042) Length = 623 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +3 Query: 414 LSTKRKRSDQDHRCTL**VTCCREARCL*VHKCKILVHNKYCV 542 +S+KR RS+ + C V CC E V KC V K CV Sbjct: 1 MSSKRTRSESSNLC----VVCCEEIEFSAVGKCDHPVCYKCCV 39 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/60 (28%), Positives = 32/60 (53%), Gaps = 3/60 (5%) Frame = -2 Query: 287 NRHGGRMRSLS--SVLNELYTDAFADGRVGLLSFYTNFLEDDALCVRCTTE-RVSLPFRT 117 +R+GGRM+SL+ S N + D + + + + ED++ + +T + LP+RT Sbjct: 1851 SRNGGRMKSLANRSGRNGVIRDLLGSQALDTAASFESLTEDESAAITGSTVCSIPLPYRT 1910 >SB_48401| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 694 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/43 (39%), Positives = 21/43 (48%) Frame = +3 Query: 414 LSTKRKRSDQDHRCTL**VTCCREARCL*VHKCKILVHNKYCV 542 +S+KR RS+ + C V CC E V KC V K CV Sbjct: 1 MSSKRTRSESSNLC----VVCCEEIEFSAVGKCDHPVCYKCCV 39 >SB_46453| Best HMM Match : DUF947 (HMM E-Value=0.13) Length = 943 Score = 28.3 bits (60), Expect = 4.6 Identities = 17/35 (48%), Positives = 22/35 (62%), Gaps = 3/35 (8%) Frame = -3 Query: 175 RTMPFA*D-APPKGLAFHFVPMW-AFLN-SLSAHR 80 R +PF+ APPKG F VP+W +F N S+ HR Sbjct: 902 RKVPFSSVLAPPKGYRFLIVPLWRSFSNRSVFGHR 936 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,905,496 Number of Sequences: 59808 Number of extensions: 428467 Number of successful extensions: 867 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 809 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 864 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1325051197 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -