BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30498X (415 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces po... 26 2.7 SPBC660.11 |tcg1|mug187|single-stranded telomeric binding protei... 25 3.5 SPBP4H10.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|... 25 4.7 SPAC890.06 |||nucleoporin Nup157/170|Schizosaccharomyces pombe|c... 25 4.7 SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosacchar... 25 6.1 SPBC3H7.06c |pof9||F-box protein Paf9|Schizosaccharomyces pombe|... 25 6.1 SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe... 24 8.1 >SPAC3A12.06c |||sodium/calcium exchanger |Schizosaccharomyces pombe|chr 1|||Manual Length = 743 Score = 25.8 bits (54), Expect = 2.7 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 5/59 (8%) Frame = -1 Query: 262 NAFCFTAEIGGAVV---PTRADSQEVLPPV--ITQIIILRVXFLLHDVIPSPWKPIVNI 101 +AF A + G+V P + + L V +T I+L + F+LHD S W+ +V I Sbjct: 188 SAFFIVAIVAGSVCLIKPFKIPRRHFLRDVAFLTGTILLVIMFVLHDGSLSIWQSLVMI 246 >SPBC660.11 |tcg1|mug187|single-stranded telomeric binding protein Tgc1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 348 Score = 25.4 bits (53), Expect = 3.5 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -3 Query: 296 IVTTAAPPFKPKRILLHGRNRRGGG 222 I + PP+ +RI L G RRG G Sbjct: 235 IAVRSLPPYIIRRIKLRGEQRRGRG 259 >SPBP4H10.14c |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 308 Score = 25.0 bits (52), Expect = 4.7 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = -1 Query: 394 AHSPPGVKWLLEPIDIYNVNAPHTLR 317 A PP +K P+DI N++A L+ Sbjct: 224 ASQPPSIKTDASPVDIKNMDAAEKLK 249 >SPAC890.06 |||nucleoporin Nup157/170|Schizosaccharomyces pombe|chr 1|||Manual Length = 1315 Score = 25.0 bits (52), Expect = 4.7 Identities = 15/56 (26%), Positives = 26/56 (46%) Frame = +3 Query: 36 RCTGVRFPQAGTNFSNEIRTQQMFTIGFHGEGITSCNKNXTRKIIICVITGGRTSC 203 RC+ + G+ F N I + F+ G HG+GI + +R ++ + SC Sbjct: 220 RCSKINI--TGSVFDNFIPS--FFSFGTHGDGIKQIAVDDSRSLLYVLRETSSVSC 271 >SPAC13G6.12c |chs1|SPAC24B11.01c|chitin synthase I|Schizosaccharomyces pombe|chr 1|||Manual Length = 859 Score = 24.6 bits (51), Expect = 6.1 Identities = 7/17 (41%), Positives = 14/17 (82%) Frame = +3 Query: 147 KNXTRKIIICVITGGRT 197 K+ +K+++C+I+ GRT Sbjct: 229 KDAWKKVVVCIISDGRT 245 >SPBC3H7.06c |pof9||F-box protein Paf9|Schizosaccharomyces pombe|chr 2|||Manual Length = 467 Score = 24.6 bits (51), Expect = 6.1 Identities = 15/46 (32%), Positives = 22/46 (47%), Gaps = 4/46 (8%) Frame = -1 Query: 283 LPHPSNRNAFCFTAEIGGAVVPTRADSQEVLP----PVITQIIILR 158 +PH + + C++ GG A S+ VLP P IT I+R Sbjct: 400 IPHQIHFSGTCYSVAAGGWQSAALAISESVLPEVNVPPITTFSIIR 445 >SPBC1683.06c |||uridine ribohydrolase |Schizosaccharomyces pombe|chr 2|||Manual Length = 310 Score = 24.2 bits (50), Expect = 8.1 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -1 Query: 400 GRAHSPPGVKWLLEPIDIYN 341 G H P V WLL P DIY+ Sbjct: 236 GPLHDPNTVMWLLRP-DIYS 254 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,893,237 Number of Sequences: 5004 Number of extensions: 38139 Number of successful extensions: 74 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 74 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 144287194 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -