BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30498X (415 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_01_0501 - 6558120-6559312,6559441-6559518,6559818-6559877,656... 27 4.5 02_05_1052 + 33770355-33773981,33774217-33774336,33774880-337749... 27 7.8 >04_01_0501 - 6558120-6559312,6559441-6559518,6559818-6559877, 6560000-6560083,6560407-6560566 Length = 524 Score = 27.5 bits (58), Expect = 4.5 Identities = 11/40 (27%), Positives = 23/40 (57%) Frame = +3 Query: 75 FSNEIRTQQMFTIGFHGEGITSCNKNXTRKIIICVITGGR 194 F+ E+ + + +G HG G+T+C T +++ ++ GR Sbjct: 400 FAREVNSYDVM-VGVHGAGLTNCVFLPTGAVLLQIVPYGR 438 >02_05_1052 + 33770355-33773981,33774217-33774336,33774880-33774996, 33775322-33775411,33775971-33776078,33776304-33776351 Length = 1369 Score = 26.6 bits (56), Expect = 7.8 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -3 Query: 272 FKPKRILLHGRNRRGGGTYPCGLTRGPTTSNYANY 168 F P+R+ RNR PC TR + S+ +Y Sbjct: 1126 FTPRRMPSPSRNRPSTPVSPCSSTRSDSASSILSY 1160 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,400,773 Number of Sequences: 37544 Number of extensions: 289872 Number of successful extensions: 581 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 572 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 581 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 742607976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -