BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30497 (790 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_10931| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_35384| Best HMM Match : PRA1 (HMM E-Value=6.7) 28 7.5 SB_28247| Best HMM Match : Na_Ca_ex (HMM E-Value=2e-27) 28 9.9 >SB_10931| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 467 Score = 46.0 bits (104), Expect = 3e-05 Identities = 22/73 (30%), Positives = 39/73 (53%) Frame = +1 Query: 277 EVIKDKLEAQTALEKKALTSPILNDVKKNVTWTPQTKRVGLIARKIGNYPLWCKDGKKVS 456 E ++ ++E Q L+ + P+ V W +KR G + K+G LW KDG+++ Sbjct: 336 EDMQVEIERQKRLQDR---QPVAIPAPGEVEWQKSSKRTGAVGVKLGMSALWLKDGRRLP 392 Query: 457 TTLLQVVDNHVIK 495 TL+Q+ D V++ Sbjct: 393 VTLIQIKDCEVVQ 405 Score = 29.5 bits (63), Expect = 3.2 Identities = 16/45 (35%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = +3 Query: 576 VGAEN-IDPSVVTKDYCGIFDSVGMLPKRHLCRFVVSPESALPNG 707 VGA N ++ + + K G F + PKR +C F V+P++ L G Sbjct: 423 VGAVNKLELNQIGKAQFGHFKRFSVRPKRKVCSFPVTPDALLTPG 467 >SB_35384| Best HMM Match : PRA1 (HMM E-Value=6.7) Length = 654 Score = 28.3 bits (60), Expect = 7.5 Identities = 14/56 (25%), Positives = 28/56 (50%) Frame = +3 Query: 537 VKWVEKQKYGCILVGAENIDPSVVTKDYCGIFDSVGMLPKRHLCRFVVSPESALPN 704 + + KQ+ +L+G + +V+TK YC +D P+ H+ + + + PN Sbjct: 164 INCIAKQEKAVLLIGEQGTAKTVMTKGYCERYD-----PELHVFKAMNFSSATTPN 214 >SB_28247| Best HMM Match : Na_Ca_ex (HMM E-Value=2e-27) Length = 236 Score = 27.9 bits (59), Expect = 9.9 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = -1 Query: 604 TLGSMFSAPTNIQPYFCFSTHFTLDFIIGLYSPEV 500 TLGS FS P N+ P C+ ++ L P+V Sbjct: 24 TLGSPFSPPENVWPRICWVLGLPINLSFFLTIPDV 58 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,201,316 Number of Sequences: 59808 Number of extensions: 535140 Number of successful extensions: 1307 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1201 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1307 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2167838629 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -