BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30496 (704 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase ... 28 0.075 AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase ... 28 0.075 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 25 0.53 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 22 4.9 >AF213012-1|AAG43568.1| 492|Apis mellifera acetylcholinesterase protein. Length = 492 Score = 28.3 bits (60), Expect = 0.075 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 276 VQSCGPNSRRVNPLPARTLVWYRTVGHRTI 187 V CG NS +N PAR + R+V +TI Sbjct: 302 VDDCGCNSTMLNENPARVMACMRSVDAKTI 331 >AB181702-1|BAE06051.1| 628|Apis mellifera acetylcholinesterase protein. Length = 628 Score = 28.3 bits (60), Expect = 0.075 Identities = 13/30 (43%), Positives = 17/30 (56%) Frame = -3 Query: 276 VQSCGPNSRRVNPLPARTLVWYRTVGHRTI 187 V CG NS +N PAR + R+V +TI Sbjct: 302 VDDCGCNSTMLNENPARVMACMRSVDAKTI 331 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 25.4 bits (53), Expect = 0.53 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -3 Query: 129 FCFLRYRRAGWLNQVLTNLCQSLWKC 52 FC+ R A W N V NL SL KC Sbjct: 538 FCYFRRNAATWKNAVRHNL--SLHKC 561 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 22.2 bits (45), Expect = 4.9 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +1 Query: 154 SSTSCSWAVTSY 189 S + C+W +TSY Sbjct: 66 SGSKCTWTITSY 77 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 180,982 Number of Sequences: 438 Number of extensions: 3638 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -