BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30494 (741 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 27 0.16 DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory pro... 23 2.6 AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B prot... 23 3.4 AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical pro... 22 6.0 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 27.1 bits (57), Expect = 0.16 Identities = 14/42 (33%), Positives = 20/42 (47%) Frame = -1 Query: 450 GSQQDRDMTPANLSGYVSAAYRANAPP*EKPPSRTLSAGTPA 325 G+ R M + +GY +Y AN PP K + LS P+ Sbjct: 72 GAYPFRPMHQNSYTGYHLGSYAANCPPSPKDDEKCLSLERPS 113 >DQ855494-1|ABH88181.1| 99|Tribolium castaneum chemosensory protein 8 protein. Length = 99 Score = 23.0 bits (47), Expect = 2.6 Identities = 8/20 (40%), Positives = 13/20 (65%) Frame = -2 Query: 509 VGILVNQQEPLSLQGNNHVE 450 +G++ Q L L GNN++E Sbjct: 14 IGVVYQVQGQLGLAGNNYIE 33 >AF227923-1|AAF36721.1| 351|Tribolium castaneum abdominal-B protein. Length = 351 Score = 22.6 bits (46), Expect = 3.4 Identities = 13/46 (28%), Positives = 18/46 (39%) Frame = -1 Query: 450 GSQQDRDMTPANLSGYVSAAYRANAPP*EKPPSRTLSAGTPALTSS 313 G + PA S + P PP T S+G+PA +S Sbjct: 4 GGIYEESPPPAPQSAATPISSSGMTSPAAAPPPATTSSGSPASVAS 49 >AM712901-1|CAN84640.1| 205|Tribolium castaneum hypothetical protein protein. Length = 205 Score = 21.8 bits (44), Expect = 6.0 Identities = 6/15 (40%), Positives = 9/15 (60%) Frame = -1 Query: 681 CWQGFFYKFLHVFEF 637 C+ + Y F H+F F Sbjct: 63 CFNSYMYAFTHIFFF 77 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,316 Number of Sequences: 336 Number of extensions: 4298 Number of successful extensions: 10 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19884055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -