BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30490 (819 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q6MSU3 Cluster: Conserved hypothetical transmembrane pr... 36 0.93 UniRef50_Q55EI8 Cluster: Filamin/ABP280 repeat-containing protei... 36 1.2 UniRef50_Q7UEX2 Cluster: Putative uncharacterized protein; n=1; ... 33 8.7 >UniRef50_Q6MSU3 Cluster: Conserved hypothetical transmembrane protein; n=1; Mycoplasma mycoides subsp. mycoides SC|Rep: Conserved hypothetical transmembrane protein - Mycoplasma mycoides subsp. mycoides SC Length = 872 Score = 36.3 bits (80), Expect = 0.93 Identities = 16/53 (30%), Positives = 28/53 (52%) Frame = -3 Query: 244 VTLYSVASLKNYYYEQ*FFFKKSTKFVYFIYATLFNLHTRARRYELLLVTVPI 86 + L + + N Y E F +K KF+Y I LF+ H R + ++ ++ VP+ Sbjct: 237 IKLKEINFILNSYIEAKIFKRKPVKFIYIINNGLFSPHIRTKFFDFIIPIVPV 289 >UniRef50_Q55EI8 Cluster: Filamin/ABP280 repeat-containing protein; n=1; Dictyostelium discoideum AX4|Rep: Filamin/ABP280 repeat-containing protein - Dictyostelium discoideum AX4 Length = 1385 Score = 35.9 bits (79), Expect = 1.2 Identities = 15/46 (32%), Positives = 26/46 (56%) Frame = -3 Query: 271 W*DNLFEYVVTLYSVASLKNYYYEQ*FFFKKSTKFVYFIYATLFNL 134 W N Y+++ + +LK Y YE FK+ T +V+F+ T+ N+ Sbjct: 542 WESNTINYIISNNNEINLKQYGYEFNQIFKEETDYVFFLSLTISNM 587 >UniRef50_Q7UEX2 Cluster: Putative uncharacterized protein; n=1; Pirellula sp.|Rep: Putative uncharacterized protein - Rhodopirellula baltica Length = 392 Score = 33.1 bits (72), Expect = 8.7 Identities = 15/32 (46%), Positives = 23/32 (71%) Frame = -2 Query: 719 QSRVTTTMLPGRCIKIYNNFYNILLLIYVCSV 624 + RVTTT+LP R +++ F + L+L+ VCSV Sbjct: 95 KDRVTTTLLPRRSVRL--QFVSALMLVMVCSV 124 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 724,577,667 Number of Sequences: 1657284 Number of extensions: 13677035 Number of successful extensions: 25967 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 25113 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25954 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 71200899835 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -