BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30490 (819 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex det... 23 2.6 DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex det... 23 2.6 DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex det... 23 2.6 DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex det... 23 2.6 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 22 5.9 >DQ325113-1|ABD14127.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.6 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +1 Query: 205 SSNSLNWQHCKVSQRIQINYLTKSKLPIAAPL 300 ++N+ N + K Q INY+ + +P+ P+ Sbjct: 98 NNNNYNNNNYKKLQYYNINYIEQIPIPVPVPI 129 >DQ325112-1|ABD14126.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.6 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +1 Query: 205 SSNSLNWQHCKVSQRIQINYLTKSKLPIAAPL 300 ++N+ N + K Q INY+ + +P+ P+ Sbjct: 98 NNNNYNNNNYKKLQYYNINYIEQIPIPVPVPI 129 >DQ325111-1|ABD14125.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.6 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +1 Query: 205 SSNSLNWQHCKVSQRIQINYLTKSKLPIAAPL 300 ++N+ N + K Q INY+ + +P+ P+ Sbjct: 98 NNNNYNNNNYKKLQYYNINYIEQIPIPVPVPI 129 >DQ325110-1|ABD14124.1| 185|Apis mellifera complementary sex determiner protein. Length = 185 Score = 23.4 bits (48), Expect = 2.6 Identities = 9/32 (28%), Positives = 18/32 (56%) Frame = +1 Query: 205 SSNSLNWQHCKVSQRIQINYLTKSKLPIAAPL 300 ++N+ N + K Q INY+ + +P+ P+ Sbjct: 98 NNNNYNNNNYKKLQYYNINYIEQIPIPVPVPI 129 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 22.2 bits (45), Expect = 5.9 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 625 YSHTHITPTHLHETHGS 575 +SH H TP H H +H + Sbjct: 423 HSHIHATPHH-HHSHAA 438 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 213,805 Number of Sequences: 438 Number of extensions: 4451 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 26096055 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -