BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30489 (578 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0454 + 9514706-9515776 28 6.2 05_03_0496 + 14706959-14707020,14707173-14707538,14708070-147082... 28 6.2 01_05_0501 + 22764978-22765896,22766087-22766349,22766613-227668... 28 6.2 >09_02_0454 + 9514706-9515776 Length = 356 Score = 27.9 bits (59), Expect = 6.2 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = -1 Query: 176 DAVGSLEIVVVSSIGAGVEFRPNDLRVVLCRGGS 75 D VGS +V V V D R VLCRGG+ Sbjct: 187 DHVGSTAVVAVVEESRVVVANCGDSRAVLCRGGA 220 >05_03_0496 + 14706959-14707020,14707173-14707538,14708070-14708209, 14708319-14708566,14708814-14708946,14709096-14709159, 14709284-14709380,14709505-14709607,14709702-14709838, 14710063-14710152,14710240-14710401 Length = 533 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/13 (69%), Positives = 11/13 (84%) Frame = -1 Query: 578 FFFFFFISNELYC 540 FFFFFF S ++YC Sbjct: 102 FFFFFFFSGDVYC 114 >01_05_0501 + 22764978-22765896,22766087-22766349,22766613-22766836, 22767419-22767749,22767968-22768372 Length = 713 Score = 27.9 bits (59), Expect = 6.2 Identities = 9/50 (18%), Positives = 26/50 (52%) Frame = +2 Query: 203 GGSRRRQQASRYCCCAWSYSYTNTDGKPETITYFADETGYHAQGESIPQV 352 G + + A + +WS+S+ + ++ + +D +GY G+++ ++ Sbjct: 333 GAGKNSKSAKVFSTISWSWSFKSAQANRQSSMHSSDASGYGYHGKTLEKL 382 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,840,825 Number of Sequences: 37544 Number of extensions: 265715 Number of successful extensions: 751 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 738 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 751 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1352600424 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -