BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30487 (737 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC2E1P3.02c |amt3||ammonium transporter Amt3|Schizosaccharomyc... 28 1.2 SPBC20F10.07 |||GRAM domain protein|Schizosaccharomyces pombe|ch... 27 3.7 SPAC16E8.05c |mde1||sequence orphan|Schizosaccharomyces pombe|ch... 26 4.9 >SPAC2E1P3.02c |amt3||ammonium transporter Amt3|Schizosaccharomyces pombe|chr 1|||Manual Length = 517 Score = 28.3 bits (60), Expect = 1.2 Identities = 10/20 (50%), Positives = 18/20 (90%) Frame = +2 Query: 560 RIIPSILLRTFIYITIIACP 619 R+IPS+++ +F+YIT++ CP Sbjct: 148 RLIPSLVI-SFLYITLVYCP 166 >SPBC20F10.07 |||GRAM domain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 764 Score = 26.6 bits (56), Expect = 3.7 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = -3 Query: 702 PYLIITWILHANQIILV 652 P+ IITW++H ++LV Sbjct: 644 PFTIITWLMHPTHLLLV 660 >SPAC16E8.05c |mde1||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 209 Score = 26.2 bits (55), Expect = 4.9 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 556 KSNNTVHIIADVYLHNNHCLPVQSTGNKVFGWYQNN 663 +S V DVY C+P++ G + GW N+ Sbjct: 149 ESGEWVIYSGDVYSAETTCIPIELVGLRYRGWKTND 184 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,930,368 Number of Sequences: 5004 Number of extensions: 59222 Number of successful extensions: 138 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 138 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 349251756 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -