BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30487 (737 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_1427 + 33491847-33491888,33493504-33493623,33493740-334939... 29 5.1 01_01_0102 + 769442-770159,770710-770805,771340-771363,771470-77... 29 5.1 >04_04_1427 + 33491847-33491888,33493504-33493623,33493740-33493976, 33494754-33495638,33495733-33495837,33495920-33496064, 33496146-33496310,33496391-33496629,33496724-33496756, 33496840-33496921,33497017-33497177,33497282-33497455, 33497549-33497731,33497832-33498019,33498155-33498251 Length = 951 Score = 28.7 bits (61), Expect = 5.1 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 315 IYVLGSLTVSCIYILMKNY*LYIKSITYNKIWNCLLL 425 + + LT CI+ MKNY +Y SIT + LL+ Sbjct: 627 VIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFLLI 663 >01_01_0102 + 769442-770159,770710-770805,771340-771363,771470-772542 Length = 636 Score = 28.7 bits (61), Expect = 5.1 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +1 Query: 586 DVYLHNNHCLPVQSTGNKVFGWYQNNLISM*NPSDN*VW 702 D+ + V STG VF WY +N+ S+ + VW Sbjct: 203 DISIFTETAKRVISTGETVFTWYTSNVTSICQQCEREVW 241 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,475,674 Number of Sequences: 37544 Number of extensions: 296154 Number of successful extensions: 504 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1945321620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -