BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30487 (737 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_23690| Best HMM Match : N6_N4_Mtase (HMM E-Value=0) 30 1.7 SB_44872| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_32009| Best HMM Match : PKD (HMM E-Value=1.9e-19) 28 6.9 SB_4423| Best HMM Match : 7tm_1 (HMM E-Value=5.5e-08) 28 9.1 >SB_23690| Best HMM Match : N6_N4_Mtase (HMM E-Value=0) Length = 297 Score = 30.3 bits (65), Expect = 1.7 Identities = 11/39 (28%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = -1 Query: 686 LGFYMLIKLFWYHPNTL-FPVDWTGKQ*LLCK*TSAIIW 573 LGF++ +W++P+ L P++W K+ + K + +W Sbjct: 73 LGFFLAEDFYWHNPSKLPSPIEWVNKRKIRAKDSVNNVW 111 >SB_44872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 29.5 bits (63), Expect = 3.0 Identities = 12/47 (25%), Positives = 25/47 (53%) Frame = -3 Query: 378 TINNFSSIYKYRKRLKILEHKLFHSSHAYKPLYEM*LKYCVKLRIEQ 238 T+NN ++Y Y + ++ ++ H PL L+Y +K +++Q Sbjct: 274 TLNNLVTVYMYNSSSSLRQYTKYNERH-LSPLKRKTLRYTIKQQVKQ 319 >SB_32009| Best HMM Match : PKD (HMM E-Value=1.9e-19) Length = 3083 Score = 28.3 bits (60), Expect = 6.9 Identities = 12/22 (54%), Positives = 16/22 (72%) Frame = -3 Query: 150 LLSFLNTRTGRRHENGYETLRN 85 LL+F+ T +R +N YETLRN Sbjct: 2646 LLAFVIKETKKRKKNNYETLRN 2667 >SB_4423| Best HMM Match : 7tm_1 (HMM E-Value=5.5e-08) Length = 1167 Score = 27.9 bits (59), Expect = 9.1 Identities = 8/25 (32%), Positives = 18/25 (72%) Frame = +1 Query: 577 IIADVYLHNNHCLPVQSTGNKVFGW 651 ++ + YL+NN+C+P++ +K F + Sbjct: 726 LLREKYLYNNYCVPIRPLDSKNFSY 750 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,412,499 Number of Sequences: 59808 Number of extensions: 386445 Number of successful extensions: 689 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 650 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 689 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1986074805 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -