BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30487 (737 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g02190.1 68417.m00291 DC1 domain-containing protein contains ... 29 3.2 At4g34520.1 68417.m04906 fatty acid elongase 1 (FAE1) identical ... 28 7.4 >At4g02190.1 68417.m00291 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 659 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/24 (50%), Positives = 15/24 (62%) Frame = +2 Query: 308 WNNLCSRIFNRFLYLYIDEKLLIV 379 W N+C RI N F Y Y D KL ++ Sbjct: 454 WCNVCGRISNGFSYQYGDMKLDVI 477 >At4g34520.1 68417.m04906 fatty acid elongase 1 (FAE1) identical to fatty acid elongase 1 [GI:881615] Length = 506 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -3 Query: 462 HNIISCIMQNIIAVTNSSRFCYM*LILYTINNFSSIY 352 HN +S + N+I VT F L+LY + + +Y Sbjct: 42 HNFLSYLQHNLITVTLLFAFTVFGLVLYIVTRPNPVY 78 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,330,239 Number of Sequences: 28952 Number of extensions: 274771 Number of successful extensions: 511 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 511 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1624036432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -