BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30481 (746 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC18B5.03 |wee1||dual specificity protein kinase Wee1|Schizosa... 30 0.40 SPBP22H7.05c |||ATPase with bromodomain protein|Schizosaccharomy... 29 0.93 SPAC20G8.04c |||mitochondrial electron transfer flavoprotein-ubi... 26 6.6 >SPCC18B5.03 |wee1||dual specificity protein kinase Wee1|Schizosaccharomyces pombe|chr 3|||Manual Length = 877 Score = 29.9 bits (64), Expect = 0.40 Identities = 23/78 (29%), Positives = 37/78 (47%), Gaps = 1/78 (1%) Frame = +1 Query: 427 NCNPDTVESRLSSDGVLTVIAPRTPAARRTSELF-PSLKPVRSGRRLRSPLRKLRATKQN 603 N NP T+ S + S T + P+ S LF P+ +P+ + R+L + ++ N Sbjct: 245 NANPSTLFSSIPSSRHTT--SNHFPSNSAQSSLFSPTARPL-TARKLGFASSQTKSAVSN 301 Query: 604 NDSRNAVNQKSVACVNFI 657 N SRN+ S +FI Sbjct: 302 NHSRNSSKDASFMMKSFI 319 >SPBP22H7.05c |||ATPase with bromodomain protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 1201 Score = 28.7 bits (61), Expect = 0.93 Identities = 18/84 (21%), Positives = 37/84 (44%), Gaps = 1/84 (1%) Frame = +1 Query: 385 YISRQFTRRYALPENCNPDTVESRLSSDGVLTVIAP-RTPAARRTSELFPSLKPVRSGRR 561 Y+ + + PE+ N + S D + V +P + RR ++ + PV+ R Sbjct: 173 YLDEDYVDGQSDPESSNASDSDFADSPDDLTKVRSPIPSRRGRRKRKMRGPILPVKKNLR 232 Query: 562 LRSPLRKLRATKQNNDSRNAVNQK 633 ++ + LRA + + D R + + Sbjct: 233 VKKAMSPLRAERNSPDFRRKLRSR 256 >SPAC20G8.04c |||mitochondrial electron transfer flavoprotein-ubiquinone oxidoreductase|Schizosaccharomyces pombe|chr 1|||Manual Length = 632 Score = 25.8 bits (54), Expect = 6.6 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +1 Query: 379 HGYISRQFTRRYALPENCNPDT 444 HG +S+ +R+ L NC P T Sbjct: 269 HGSLSKSIIKRFNLRGNCEPQT 290 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,758,162 Number of Sequences: 5004 Number of extensions: 54473 Number of successful extensions: 165 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 165 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 355273338 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -