BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30481 (746 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phospha... 30 0.027 AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone este... 22 5.3 AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. 22 5.3 AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. 22 5.3 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 9.3 AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. 21 9.3 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.3 >AF023666-1|AAC14552.1| 363|Apis mellifera sn-glycerol-3-phosphate dehydrogenase protein. Length = 363 Score = 29.9 bits (64), Expect = 0.027 Identities = 26/98 (26%), Positives = 41/98 (41%), Gaps = 2/98 (2%) Frame = +1 Query: 277 VNLDVQHFSPEEISVKTADGYVIVEGKHEERQDEHGYISRQFTRRYALPEN--CNPDTVE 450 + ++ +FS E V I+ GK + + ++ + LP N PD VE Sbjct: 23 IGINAANFSNFEDRVTMYVYEEIINGKKLTEIINETHENVKYLPGHKLPPNIIAIPDVVE 82 Query: 451 SRLSSDGVLTVIAPRTPAARRTSELFPSLKPVRSGRRL 564 + +D +LT + P R S LF +KP G L Sbjct: 83 AAKDAD-ILTFVVPHQFIKRICSALFGKIKPTAIGLSL 119 >AY647436-1|AAU81605.1| 567|Apis mellifera juvenile hormone esterase protein. Length = 567 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 596 FVALNFRSGLLNLLPDRTGLSDGN 525 FV +N+R G+L L + GN Sbjct: 153 FVTINYRLGILGFLSTEDEVVPGN 176 >AY526235-1|AAS20468.1| 169|Apis mellifera esterase protein. Length = 169 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 596 FVALNFRSGLLNLLPDRTGLSDGN 525 FV +N+R G+L L + GN Sbjct: 24 FVTINYRLGILGFLSTEDEVVPGN 47 >AB083009-1|BAC54130.1| 567|Apis mellifera esterase protein. Length = 567 Score = 22.2 bits (45), Expect = 5.3 Identities = 9/24 (37%), Positives = 13/24 (54%) Frame = -1 Query: 596 FVALNFRSGLLNLLPDRTGLSDGN 525 FV +N+R G+L L + GN Sbjct: 153 FVTINYRLGILGFLSTEDEVVPGN 176 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = -3 Query: 510 SGSRSPGSDHGQHAVRGQPRFDSVRVAVF 424 SGS +PG+ + P F RVA + Sbjct: 391 SGSSTPGTGREHDPAKFPPSFRISRVAAY 419 >AY703685-1|AAU12681.1| 200|Apis mellifera abdominal-A protein. Length = 200 Score = 21.4 bits (43), Expect = 9.3 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 487 APRTPAARRTSELFP 531 A +PAAR TS ++P Sbjct: 76 ASTSPAARTTSSMYP 90 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.3 Identities = 7/20 (35%), Positives = 13/20 (65%) Frame = +1 Query: 250 HHSNKDKFQVNLDVQHFSPE 309 H +N D++ L ++H SP+ Sbjct: 659 HVTNMDQYNSILMIEHLSPD 678 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 182,809 Number of Sequences: 438 Number of extensions: 3650 Number of successful extensions: 13 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23388480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -