BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30478 (531 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC29B5.03c |rpl26||60S ribosomal protein L26|Schizosaccharomyc... 108 4e-25 SPAC328.03 |tps1||alpha,alpha-trehalose-phosphate synthase [UDP-... 25 5.3 SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pom... 25 7.0 SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces... 25 9.3 >SPBC29B5.03c |rpl26||60S ribosomal protein L26|Schizosaccharomyces pombe|chr 2|||Manual Length = 126 Score = 108 bits (260), Expect = 4e-25 Identities = 50/89 (56%), Positives = 70/89 (78%), Gaps = 1/89 (1%) Frame = +2 Query: 29 MKFNKQVTSSRRKNRKRHFSAPSHIRRVLMSSPLSKELRQKFNVKSMPIRKDDEVQVVRG 208 MKF++ VTSSRRK RK HF APS +RRVLMS+PLSKELR+++ ++S+P+R+DD++ V+RG Sbjct: 1 MKFSRDVTSSRRKQRKAHFGAPSSVRRVLMSAPLSKELREQYKIRSLPVRRDDQITVIRG 60 Query: 209 HYKGQQVGKVMQVYRKSLLYTL-RGFKEK 292 KG++ GK+ VYRK L + R +EK Sbjct: 61 SNKGRE-GKITSVYRKKFLLLIERVTREK 88 Score = 56.8 bits (131), Expect = 2e-09 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +1 Query: 256 KFVVYIERIQREKANGATAYVGIHPSKCVIVKLKMNKDRKAILDRR 393 KF++ IER+ REKANGA+A VGI SK VI KL ++KDRK ++ R+ Sbjct: 76 KFLLLIERVTREKANGASAPVGIDASKVVITKLHLDKDRKDLIVRK 121 >SPAC328.03 |tps1||alpha,alpha-trehalose-phosphate synthase [UDP-forming]|Schizosaccharomyces pombe|chr 1|||Manual Length = 513 Score = 25.4 bits (53), Expect = 5.3 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 1/42 (2%) Frame = +1 Query: 316 VGIHPSKCV-IVKLKMNKDRKAILDRRAKGRLAALGKDKGKY 438 +GI P K +K + KDR A ++RR +G +G D+ Y Sbjct: 256 IGIDPEKFSDALKSDVVKDRIASIERRLQGVKVIVGVDRLDY 297 >SPAC22H10.03c |kap114||karyopherin Kap14|Schizosaccharomyces pombe|chr 1|||Manual Length = 986 Score = 25.0 bits (52), Expect = 7.0 Identities = 11/27 (40%), Positives = 13/27 (48%) Frame = -1 Query: 438 VFTLVFAKCSQSALCSAIEDCFAVFIH 358 +F LV S +C IED F IH Sbjct: 588 LFNLVATNASDPYICGIIEDTFEDIIH 614 >SPBP16F5.03c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 3699 Score = 24.6 bits (51), Expect = 9.3 Identities = 8/40 (20%), Positives = 20/40 (50%) Frame = +1 Query: 4 CRFGEERQNEVQQAGDFLKKEKQEEAFQCSFTYKASVDVL 123 C F ++ +E++ G +L + +F C + V+++ Sbjct: 3300 CEFHHQKFDEIEVPGQYLLHKDNNNSFSCIERFLPEVELI 3339 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,977,888 Number of Sequences: 5004 Number of extensions: 40620 Number of successful extensions: 140 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 135 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 140 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 218398248 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -