BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30477 (501 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_03_0035 - 9130678-9130887,9130963-9131255,9132328-9132604 32 0.23 02_04_0258 + 21339682-21339806,21340635-21340730,21340905-213409... 27 6.4 >11_03_0035 - 9130678-9130887,9130963-9131255,9132328-9132604 Length = 259 Score = 32.3 bits (70), Expect = 0.23 Identities = 21/77 (27%), Positives = 30/77 (38%) Frame = +2 Query: 23 GADNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQYSEDKAFKKFVLCFFNKSAI 202 G D ++L E + + V+ + NAAK Y E K K ++C F K Sbjct: 45 GEDKINLEEMLRHAEPEVPMGSVRGLNNFEALQNAAKEVMYDESKGCNKKIVCEFGKVTK 104 Query: 203 LNSDGTLNMDVALAKLP 253 S GT + K P Sbjct: 105 KPSKGTKRKKLEKTKKP 121 >02_04_0258 + 21339682-21339806,21340635-21340730,21340905-21340980, 21341085-21341143,21341280-21341380,21341447-21341773, 21341861-21342021,21342100-21342303,21342735-21342966, 21343629-21344239 Length = 663 Score = 27.5 bits (58), Expect = 6.4 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +2 Query: 23 GADNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQYS 148 G+ N H +Q KA Q ++ E+ ST N + G+Y+ Sbjct: 436 GSSNTHKQLSQPAKAGQTSTGTTSEADGSTSAYNGNQAGRYA 477 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,037,309 Number of Sequences: 37544 Number of extensions: 194777 Number of successful extensions: 534 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 525 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1059318940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -