BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30477 (501 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 34 0.001 DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 33 0.001 DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 26 0.19 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 25 0.34 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 25 0.34 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 25 0.34 DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 24 0.77 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 1.8 AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 22 3.1 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 22 4.1 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 22 4.1 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 22 4.1 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 33.9 bits (74), Expect = 0.001 Identities = 14/67 (20%), Positives = 34/67 (50%), Gaps = 1/67 (1%) Frame = +2 Query: 56 KEKAKQYTSECVKESGVSTEVINAAKTGQYSEDKAFKKFVLCFFNKSAILN-SDGTLNMD 232 +E +Y +C+ E+ + E + A + G++ ED+ K + C K +++ +G + + Sbjct: 33 REMTSKYRKKCIGETKTTIEDVEATEYGEFPEDEKLKCYFNCVLEKFNVMDKKNGKIRYN 92 Query: 233 VALAKLP 253 + +P Sbjct: 93 LLKKVIP 99 Score = 22.6 bits (46), Expect = 2.4 Identities = 6/26 (23%), Positives = 14/26 (53%) Frame = +1 Query: 283 VLEQCKDKTGQDAADKAFEIFQCYYK 360 +++ C + D +K+F +C Y+ Sbjct: 109 MIDSCSNVDSSDKCEKSFMFMKCMYE 134 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 33.5 bits (73), Expect = 0.001 Identities = 14/54 (25%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +2 Query: 80 SECVKESGVSTEVINAAKTGQYS-EDKAFKKFVLCFFNKSAILNSDGTLNMDVA 238 S C+ ++G++ ++IN G+ + ED+ + ++ C K + ++ DG N V+ Sbjct: 31 SICMAKTGINKQIINDVNDGKINIEDENVQLYIECAMKKFSFVDKDGNFNEHVS 84 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 26.2 bits (55), Expect = 0.19 Identities = 7/30 (23%), Positives = 17/30 (56%) Frame = +1 Query: 265 KSEAQSVLEQCKDKTGQDAADKAFEIFQCY 354 + + + +CK +D +KA+++ +CY Sbjct: 89 QDSTKKLFNKCKSIQNEDPCEKAYQLVKCY 118 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 25.4 bits (53), Expect = 0.34 Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = +1 Query: 265 KSEAQSVLEQCKDKTGQDAADKAFEIFQCYYK-GTKTHILF 384 ++E Q + +CK D + A+ +CY + +T+ LF Sbjct: 105 RAEVQKAISECKGIAKGDNCEYAYRFNKCYAELSPRTYYLF 145 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 25.4 bits (53), Expect = 0.34 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 265 KSEAQSVLEQCKDKTGQDAADKAFEIFQC 351 + AQSV+ +C +G D +K + + +C Sbjct: 104 QERAQSVMGKCLPTSGSDNCNKIYNLAKC 132 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 25.4 bits (53), Expect = 0.34 Identities = 9/29 (31%), Positives = 17/29 (58%) Frame = +1 Query: 265 KSEAQSVLEQCKDKTGQDAADKAFEIFQC 351 + AQSV+ +C +G D +K + + +C Sbjct: 104 QERAQSVMGKCLPTSGSDNCNKIYNLAKC 132 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 24.2 bits (50), Expect = 0.77 Identities = 7/32 (21%), Positives = 18/32 (56%) Frame = +1 Query: 259 VNKSEAQSVLEQCKDKTGQDAADKAFEIFQCY 354 ++ + ++ CKD T ++ K+ ++ QC+ Sbjct: 91 LDSEQVNRLVNNCKDITESNSCKKSSKLLQCF 122 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 1.8 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = +2 Query: 314 KTQPIKPSRSSNATTKGPRHIFYF 385 KT K R +T+K PR F+F Sbjct: 423 KTHVWKKGRDKKSTSKKPRRKFHF 446 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 22.2 bits (45), Expect = 3.1 Identities = 10/38 (26%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = +1 Query: 277 QSVLEQCKDK--TGQDAADKAFEIFQCYYKGTKTHILF 384 + ++ C+++ TG D K ++ QC+YK F Sbjct: 106 KEIVAVCRNEEYTGDDC-QKTYQYVQCHYKQNPEKFFF 142 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.8 bits (44), Expect = 4.1 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +2 Query: 5 FAVFNCGADNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQY 145 F+++ D H KE +YT+E + GVS E + K Y Sbjct: 418 FSIYKTILDYYH---KYKENLPKYTTEELNFPGVSIESVTVDKLITY 461 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.8 bits (44), Expect = 4.1 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +2 Query: 5 FAVFNCGADNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQY 145 F+++ D H KE +YT+E + GVS E + K Y Sbjct: 418 FSIYKTILDYYH---KYKENLPKYTTEELNFPGVSIESVTVDKLITY 461 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.8 bits (44), Expect = 4.1 Identities = 14/47 (29%), Positives = 21/47 (44%) Frame = +2 Query: 5 FAVFNCGADNVHLTETQKEKAKQYTSECVKESGVSTEVINAAKTGQY 145 F+++ D H KE +YT+E + GVS E + K Y Sbjct: 44 FSIYKTILDYYH---KYKENLPKYTTEELNFPGVSIESVTVDKLITY 87 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 117,175 Number of Sequences: 438 Number of extensions: 2059 Number of successful extensions: 13 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13741392 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -