BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30477 (501 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g79360.1 68414.m09248 transporter-related low similarity to S... 30 1.0 At5g45230.1 68418.m05551 disease resistance protein (TIR-NBS-LRR... 29 1.3 At2g29340.2 68415.m03563 short-chain dehydrogenase/reductase (SD... 29 1.3 At2g29340.1 68415.m03564 short-chain dehydrogenase/reductase (SD... 29 1.3 At1g06720.1 68414.m00714 expressed protein contains Pfam domain,... 27 7.1 At1g03780.2 68414.m00358 targeting protein-related similar to mi... 27 7.1 At1g03780.1 68414.m00359 targeting protein-related similar to mi... 27 7.1 >At1g79360.1 68414.m09248 transporter-related low similarity to SP|O76082 Organic cation/carnitine transporter 2 (Solute carrier family 22, member 5) (High-affinity sodium-dependent carnitine cotransporter) {Homo sapiens}; contains Pfam profile PF00083: major facilitator superfamily protein Length = 527 Score = 29.9 bits (64), Expect = 1.0 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -1 Query: 372 CLGPFVVALEDLEGFIGCVLPGLILA 295 C G FV L + F+GC++ GL+L+ Sbjct: 107 CAGSFVKGLPESSFFVGCLIGGLVLS 132 >At5g45230.1 68418.m05551 disease resistance protein (TIR-NBS-LRR class), putative domain signature TIR-NBS-LRR exists, suggestive of a disease resistance protein. Length = 1231 Score = 29.5 bits (63), Expect = 1.3 Identities = 10/18 (55%), Positives = 15/18 (83%) Frame = -2 Query: 242 LAQHPCSVYHLSSRLRIC 189 +A+ PCS++HLSS R+C Sbjct: 831 IAELPCSIFHLSSLRRLC 848 >At2g29340.2 68415.m03563 short-chain dehydrogenase/reductase (SDR) family protein similar to tropinone reductase-I GI:424160 from [Datura stramonium] Length = 262 Score = 29.5 bits (63), Expect = 1.3 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +2 Query: 41 LTETQKEKAKQYTSECVKESGVSTEVINAAKTGQYSEDKAFKKFVL 178 L + K A ++ + ++ + V+ VIN + Y ED +FKK +L Sbjct: 166 LIQLAKNLACEWAKDGIRANAVAPNVINTPLSQSYLEDVSFKKALL 211 >At2g29340.1 68415.m03564 short-chain dehydrogenase/reductase (SDR) family protein similar to tropinone reductase-I GI:424160 from [Datura stramonium] Length = 307 Score = 29.5 bits (63), Expect = 1.3 Identities = 14/46 (30%), Positives = 25/46 (54%) Frame = +2 Query: 41 LTETQKEKAKQYTSECVKESGVSTEVINAAKTGQYSEDKAFKKFVL 178 L + K A ++ + ++ + V+ VIN + Y ED +FKK +L Sbjct: 166 LIQLAKNLACEWAKDGIRANAVAPNVINTPLSQSYLEDVSFKKALL 211 >At1g06720.1 68414.m00714 expressed protein contains Pfam domain, PF04950: Protein of unknown function (DUF663) Length = 1147 Score = 27.1 bits (57), Expect = 7.1 Identities = 14/54 (25%), Positives = 25/54 (46%) Frame = +2 Query: 92 KESGVSTEVINAAKTGQYSEDKAFKKFVLCFFNKSAILNSDGTLNMDVALAKLP 253 K V +++ + + +YS D+ K + FF K +S+ L + A LP Sbjct: 379 KGRDVGEDLVKSLQNTKYSVDEKLDKTFINFFGKKTSASSETKLKAEDAYHSLP 432 >At1g03780.2 68414.m00358 targeting protein-related similar to microtubule-associated protein / targeting protein for Xklp2 ((TPX2) GI:8926138) {Homo sapiens}; similar to Restricted expression proliferation associated protein 100 (p100) (Differentially expressed in lung cells 2) (DIL-2) (Targeting protein for Xklp2) (C20orf1 protein) (C20orf2 protein) (Protein FLS353)(SP:Q9ULW0) {Homo sapiens} Length = 725 Score = 27.1 bits (57), Expect = 7.1 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +2 Query: 155 KAFKKFVLCFFNKSAILNSDGTLNMDVALAKL-PLVLINLKPKAY*NSARIRPGKTQPIK 331 ++FK +C FN++ + TL L + P+V + +P A + P K +K Sbjct: 66 RSFKVEAMCNFNEA----EEETLKDKEPLEPVVPIVSLQSQPSQA-KKAEVAPSKASTVK 120 Query: 332 PSRSSN 349 PSR S+ Sbjct: 121 PSRISS 126 >At1g03780.1 68414.m00359 targeting protein-related similar to microtubule-associated protein / targeting protein for Xklp2 ((TPX2) GI:8926138) {Homo sapiens}; similar to Restricted expression proliferation associated protein 100 (p100) (Differentially expressed in lung cells 2) (DIL-2) (Targeting protein for Xklp2) (C20orf1 protein) (C20orf2 protein) (Protein FLS353)(SP:Q9ULW0) {Homo sapiens} Length = 687 Score = 27.1 bits (57), Expect = 7.1 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +2 Query: 155 KAFKKFVLCFFNKSAILNSDGTLNMDVALAKL-PLVLINLKPKAY*NSARIRPGKTQPIK 331 ++FK +C FN++ + TL L + P+V + +P A + P K +K Sbjct: 66 RSFKVEAMCNFNEA----EEETLKDKEPLEPVVPIVSLQSQPSQA-KKAEVAPSKASTVK 120 Query: 332 PSRSSN 349 PSR S+ Sbjct: 121 PSRISS 126 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,223,650 Number of Sequences: 28952 Number of extensions: 168821 Number of successful extensions: 504 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 492 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 504 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 888318720 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -