BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30473X (558 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. 33 0.001 DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. 33 0.001 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 27 0.097 DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 27 0.17 AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding prote... 26 0.22 AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding pro... 26 0.22 DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 25 0.39 DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. 24 0.91 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 24 1.2 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 23 2.1 AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding prote... 22 3.7 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 22 4.8 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 22 4.8 EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. 21 6.4 AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. 21 6.4 AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. 21 6.4 >DQ435332-1|ABD92647.1| 135|Apis mellifera OBP15 protein. Length = 135 Score = 33.5 bits (73), Expect = 0.001 Identities = 14/54 (25%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = -1 Query: 420 SECVKESGVSTEVINAAKTGQYS-EDKAFKKFVLCFFNKSAILNSDGTLNMDVA 262 S C+ ++G++ ++IN G+ + ED+ + ++ C K + ++ DG N V+ Sbjct: 31 SICMAKTGINKQIINDVNDGKINIEDENVQLYIECAMKKFSFVDKDGNFNEHVS 84 >DQ435328-1|ABD92643.1| 143|Apis mellifera OBP11 protein. Length = 143 Score = 33.5 bits (73), Expect = 0.001 Identities = 12/51 (23%), Positives = 27/51 (52%) Frame = -1 Query: 444 KEKAKQYTSECVKESGVSTEVINAAKTGQYSEDKAFKKFVLCFFNKSAILN 292 +E +Y +C+ E+ + E + A + G++ ED+ K + C K +++ Sbjct: 33 REMTSKYRKKCIGETKTTIEDVEATEYGEFPEDEKLKCYFNCVLEKFNVMD 83 Score = 24.6 bits (51), Expect = 0.69 Identities = 9/39 (23%), Positives = 18/39 (46%) Frame = -3 Query: 256 KLPPGVNKSEAQSVLEQCKDKTGQDAADKAFEIFQCYYK 140 K+ P K +++ C + D +K+F +C Y+ Sbjct: 96 KVIPEAFKEIGVEMIDSCSNVDSSDKCEKSFMFMKCMYE 134 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 27.5 bits (58), Expect = 0.097 Identities = 20/90 (22%), Positives = 41/90 (45%) Frame = -1 Query: 558 LGLLLQQDQKMMYLSFDC**YCLVPNSARDNVHLTETQKEKAKQYTSECVKESGVSTEVI 379 + +L + D K Y+ F Y + PN D+ + E Q K + +S + + T ++ Sbjct: 146 IAVLYRPDTK--YMKFPAI-YEIYPNYFFDSSVIEEAQNLKMSRGSSVVTGMNNIETYIV 202 Query: 378 NAAKTGQYSEDKAFKKFVLCFFNKSAILNS 289 N + +Y + ++ L +F + LN+ Sbjct: 203 NTNYSSKYMREYNDPEYKLDYFMEDVELNA 232 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 26.6 bits (56), Expect = 0.17 Identities = 8/34 (23%), Positives = 18/34 (52%) Frame = -3 Query: 247 PGVNKSEAQSVLEQCKDKTGQDAADKAFEIFQCY 146 P + + + +CK +D +KA+++ +CY Sbjct: 85 PRSMQDSTKKLFNKCKSIQNEDPCEKAYQLVKCY 118 >AF393494-1|AAL60419.1| 144|Apis mellifera odorant binding protein ASP1 protein. Length = 144 Score = 26.2 bits (55), Expect = 0.22 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 253 LPPGVNKSEAQSVLEQCKDKTGQDAADKAFEIFQC 149 L P + AQSV+ +C +G D +K + + +C Sbjct: 98 LLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKC 132 >AF166496-1|AAD51944.1| 144|Apis mellifera pheromone-binding protein ASP1 protein. Length = 144 Score = 26.2 bits (55), Expect = 0.22 Identities = 11/35 (31%), Positives = 19/35 (54%) Frame = -3 Query: 253 LPPGVNKSEAQSVLEQCKDKTGQDAADKAFEIFQC 149 L P + AQSV+ +C +G D +K + + +C Sbjct: 98 LLPDQLQERAQSVMGKCLPTSGSDNCNKIYNLAKC 132 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 25.4 bits (53), Expect = 0.39 Identities = 11/41 (26%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -3 Query: 235 KSEAQSVLEQCKDKTGQDAADKAFEIFQCYYK-GTKTHILF 116 ++E Q + +CK D + A+ +CY + +T+ LF Sbjct: 105 RAEVQKAISECKGIAKGDNCEYAYRFNKCYAELSPRTYYLF 145 >DQ435330-1|ABD92645.1| 132|Apis mellifera OBP13 protein. Length = 132 Score = 24.2 bits (50), Expect = 0.91 Identities = 7/32 (21%), Positives = 18/32 (56%) Frame = -3 Query: 241 VNKSEAQSVLEQCKDKTGQDAADKAFEIFQCY 146 ++ + ++ CKD T ++ K+ ++ QC+ Sbjct: 91 LDSEQVNRLVNNCKDITESNSCKKSSKLLQCF 122 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 23.8 bits (49), Expect = 1.2 Identities = 19/90 (21%), Positives = 40/90 (44%) Frame = -1 Query: 558 LGLLLQQDQKMMYLSFDC**YCLVPNSARDNVHLTETQKEKAKQYTSECVKESGVSTEVI 379 + +L + D K Y+ F Y + PN D+ + E Q K + +S + + T ++ Sbjct: 146 IAVLYRPDTK--YMKFPAI-YEIYPNYFFDSSVIEEAQNLKMSRGSSVVTGMNNIETYIV 202 Query: 378 NAAKTGQYSEDKAFKKFVLCFFNKSAILNS 289 N + + + ++ L +F + LN+ Sbjct: 203 NTNYSSKNMREYNDPEYKLDYFMEDVELNA 232 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.0 bits (47), Expect = 2.1 Identities = 10/24 (41%), Positives = 13/24 (54%) Frame = -1 Query: 186 KTQPIKPSRSSNATTKGPRHIFYF 115 KT K R +T+K PR F+F Sbjct: 423 KTHVWKKGRDKKSTSKKPRRKFHF 446 >AF393497-1|AAL60422.1| 143|Apis mellifera odorant binding protein ASP5 protein. Length = 143 Score = 22.2 bits (45), Expect = 3.7 Identities = 10/38 (26%), Positives = 19/38 (50%), Gaps = 2/38 (5%) Frame = -3 Query: 223 QSVLEQCKDK--TGQDAADKAFEIFQCYYKGTKTHILF 116 + ++ C+++ TG D K ++ QC+YK F Sbjct: 106 KEIVAVCRNEEYTGDDC-QKTYQYVQCHYKQNPEKFFF 142 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 21.8 bits (44), Expect = 4.8 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 495 CLVPNSARDNVHLTETQKEKAKQYT 421 CL P+S H+TE + + K+ T Sbjct: 55 CLTPDSVFFKSHITEAFQTQCKKCT 79 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 21.8 bits (44), Expect = 4.8 Identities = 9/25 (36%), Positives = 14/25 (56%) Frame = -1 Query: 495 CLVPNSARDNVHLTETQKEKAKQYT 421 CL P+S H+TE + + K+ T Sbjct: 55 CLTPDSVFFKSHITEAFQTQCKKCT 79 >EF625896-1|ABR45903.1| 683|Apis mellifera hexamerin protein. Length = 683 Score = 21.4 bits (43), Expect = 6.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 444 KEKAKQYTSECVKESGVSTEVINAAKTGQY 355 KE +YT+E + GVS E + K Y Sbjct: 432 KENLPKYTTEELNFPGVSIESVTVDKLITY 461 >AY601637-1|AAT11850.1| 683|Apis mellifera hexamerin 70b protein. Length = 683 Score = 21.4 bits (43), Expect = 6.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 444 KEKAKQYTSECVKESGVSTEVINAAKTGQY 355 KE +YT+E + GVS E + K Y Sbjct: 432 KENLPKYTTEELNFPGVSIESVTVDKLITY 461 >AF134821-1|AAD40236.1| 226|Apis mellifera hexamerin protein. Length = 226 Score = 21.4 bits (43), Expect = 6.4 Identities = 11/30 (36%), Positives = 15/30 (50%) Frame = -1 Query: 444 KEKAKQYTSECVKESGVSTEVINAAKTGQY 355 KE +YT+E + GVS E + K Y Sbjct: 58 KENLPKYTTEELNFPGVSIESVTVDKLITY 87 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 144,260 Number of Sequences: 438 Number of extensions: 2745 Number of successful extensions: 17 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16072521 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -