BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30472 (704 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_05_0145 + 18588201-18588242,18588925-18589044,18589201-185894... 31 0.67 03_06_0691 + 35576319-35576702,35576803-35576885,35576972-355770... 30 1.6 01_05_0233 - 19641309-19641871,19650741-19650892,19651193-19651308 30 2.1 08_02_0448 + 17239987-17240489,17240633-17241042,17241183-172414... 29 3.6 09_02_0027 + 3105963-3106276,3106298-3107027,3107069-3107134,310... 28 8.3 08_02_0407 + 16818621-16819403 28 8.3 >01_05_0145 + 18588201-18588242,18588925-18589044,18589201-18589457, 18589980-18590048,18590091-18590115 Length = 170 Score = 31.5 bits (68), Expect = 0.67 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +1 Query: 442 ILYDSHFSLXLQIEKKNKLFHKGSHVVYSKATSWPSIF 555 ++ D H ++ + IE + HKG+H V S + W +F Sbjct: 52 VVEDLHLAIEIFIESVFDIVHKGAHYVLSPSEVWKKLF 89 >03_06_0691 + 35576319-35576702,35576803-35576885,35576972-35577012, 35577974-35578018,35578217-35578371,35579116-35579265, 35579386-35579481,35579738-35579854,35579969-35580088, 35580170-35580262,35580351-35580467,35580815-35580931, 35581089-35581151,35581238-35581399 Length = 580 Score = 30.3 bits (65), Expect = 1.6 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = +2 Query: 350 RCSRRRGRIVLCRVEILGIVDETDDVCAV 436 RCSRRRG +V C+ +V DD +V Sbjct: 41 RCSRRRGLVVRCQSGAAAVVLNKDDAASV 69 >01_05_0233 - 19641309-19641871,19650741-19650892,19651193-19651308 Length = 276 Score = 29.9 bits (64), Expect = 2.1 Identities = 17/60 (28%), Positives = 28/60 (46%), Gaps = 1/60 (1%) Frame = -2 Query: 184 ARYSGAPDESLDGFIDAVEAYKECANVS-ETIALRGLSMLLTHEAATWWQGVKTTMNKWD 8 A +S + +E + AV Y + VS + + LR L +A W+ + T+N WD Sbjct: 74 APWSKSGEEKIPSATGAVPGYLQHLRVSPDAVRLRLFPFSLLGKAKQWFYANRATVNTWD 133 >08_02_0448 + 17239987-17240489,17240633-17241042,17241183-17241406, 17241590-17242018,17244726-17244809 Length = 549 Score = 29.1 bits (62), Expect = 3.6 Identities = 14/49 (28%), Positives = 22/49 (44%) Frame = -2 Query: 154 LDGFIDAVEAYKECANVSETIALRGLSMLLTHEAATWWQGVKTTMNKWD 8 L F++ Y S+ + LR S L +A W+ + T+N WD Sbjct: 33 LQQFLEIYSTYTVKGVSSDAVRLRLFSFSLLGKAKQWFYANRMTVNTWD 81 >09_02_0027 + 3105963-3106276,3106298-3107027,3107069-3107134, 3107192-3107324,3108985-3109088 Length = 448 Score = 27.9 bits (59), Expect = 8.3 Identities = 15/57 (26%), Positives = 25/57 (43%) Frame = -2 Query: 178 YSGAPDESLDGFIDAVEAYKECANVSETIALRGLSMLLTHEAATWWQGVKTTMNKWD 8 + G P+E + + Y S+T+ LR L +A W+ + T+N WD Sbjct: 92 FCGMPNEDANAHL---HTYTMKGVSSDTVRLRLFPFSLLGKAKQWFYANRATINTWD 145 >08_02_0407 + 16818621-16819403 Length = 260 Score = 27.9 bits (59), Expect = 8.3 Identities = 17/53 (32%), Positives = 27/53 (50%), Gaps = 2/53 (3%) Frame = -1 Query: 353 IGKHFRQRHGRHD--VYVATQPRVNLLSLRYFYIQSQPIAAVIAPARSTCTRK 201 IG + R GR D V V PR+ +L + +++ P +AV+ R T+K Sbjct: 26 IGLSLKARRGRRDIDVVVLMIPRLEILDVASRFLRRIPQSAVLFGLRGAKTKK 78 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,569,532 Number of Sequences: 37544 Number of extensions: 294151 Number of successful extensions: 925 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 894 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 925 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1815633512 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -