BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30472 (704 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic pr... 26 1.0 AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dp... 23 7.1 >AY578800-1|AAT07305.1| 379|Anopheles gambiae decapentaplegic protein. Length = 379 Score = 26.2 bits (55), Expect = 1.0 Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 2/59 (3%) Frame = -3 Query: 312 LRGNATK--SKLVEFEILLHTVSTNRSGHRPRPLNLHTETSPRARLATAERQTNHLTDL 142 LR NA + V+ + LL T T+ H+ RP+ ++ RAR A+A+R + +L Sbjct: 220 LRRNAAERHDSWVQKQPLLFTY-TDDGRHKQRPIRDAISSANRARRASAKRSSRRKNEL 277 >AY578803-1|AAT07308.1| 474|Anopheles gambiae mothers against Dpp protein. Length = 474 Score = 23.4 bits (48), Expect = 7.1 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = +1 Query: 514 HVVYSKATSWPSIFNVHE 567 HV+Y + WP + + HE Sbjct: 99 HVIYCRVWRWPDLQSHHE 116 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 649,331 Number of Sequences: 2352 Number of extensions: 11454 Number of successful extensions: 20 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 71922660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -