BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30471 (706 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. 23 1.8 DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory pro... 22 5.6 >AF225975-1|AAF74117.1| 256|Tribolium castaneum unknown protein. Length = 256 Score = 23.4 bits (48), Expect = 1.8 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = -3 Query: 665 PASSDSMTTRTHHFIHLILVYHSRLINTNKQLS*FEIKTIQS 540 P + + + HH IH ++YH+ + N+ S IQS Sbjct: 32 PRHFNPPSDKLHHPIHQTVIYHNNPRDPNRARSVSYSTVIQS 73 >DQ855504-1|ABH88191.1| 124|Tribolium castaneum chemosensory protein 18 protein. Length = 124 Score = 21.8 bits (44), Expect = 5.6 Identities = 10/19 (52%), Positives = 14/19 (73%), Gaps = 3/19 (15%) Frame = -3 Query: 377 IVLTCLYVIFL---VLEDN 330 +VLTC +V+FL V+ DN Sbjct: 7 LVLTCAHVVFLEEYVIPDN 25 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,046 Number of Sequences: 336 Number of extensions: 3310 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18634795 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -