BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30471 (706 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ000517-1|CAA04154.1| 892|Homo sapiens spinocerebellar ataxia ... 30 9.3 AF032105-1|AAC39765.1| 892|Homo sapiens ataxin-7 protein. 30 9.3 AF032103-1|AAC19163.1| 789|Homo sapiens ataxin-7 protein. 30 9.3 >AJ000517-1|CAA04154.1| 892|Homo sapiens spinocerebellar ataxia 7 protein. Length = 892 Score = 29.9 bits (64), Expect = 9.3 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = -3 Query: 203 RTSLEPGSMLPVATTLNATVERNSPLRGSTTLDPESFSVPARYTS 69 RT+ P S V+ ATV + L ST + P S SVPA T+ Sbjct: 580 RTNSVPTSQCGVSYLAAATVSTSPVLLSSTCISPNSKSVPAHGTT 624 >AF032105-1|AAC39765.1| 892|Homo sapiens ataxin-7 protein. Length = 892 Score = 29.9 bits (64), Expect = 9.3 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = -3 Query: 203 RTSLEPGSMLPVATTLNATVERNSPLRGSTTLDPESFSVPARYTS 69 RT+ P S V+ ATV + L ST + P S SVPA T+ Sbjct: 580 RTNSVPTSQCGVSYLAAATVSTSPVLLSSTCISPNSKSVPAHGTT 624 >AF032103-1|AAC19163.1| 789|Homo sapiens ataxin-7 protein. Length = 789 Score = 29.9 bits (64), Expect = 9.3 Identities = 18/45 (40%), Positives = 23/45 (51%) Frame = -3 Query: 203 RTSLEPGSMLPVATTLNATVERNSPLRGSTTLDPESFSVPARYTS 69 RT+ P S V+ ATV + L ST + P S SVPA T+ Sbjct: 477 RTNSVPTSQCGVSYLAAATVSTSPVLLSSTCISPNSKSVPAHGTT 521 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 94,921,678 Number of Sequences: 237096 Number of extensions: 1829953 Number of successful extensions: 3965 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3965 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 8175213644 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -