BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30471 (706 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 24 1.2 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 24 1.2 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 24 1.2 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 21 8.6 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +1 Query: 106 SNVVEPRSGEFRSTVAFKVVATGSIEPGSSEVLWCRDG 219 ++++ P EF+ + K V G++E +SE +DG Sbjct: 278 NDILRPYVPEFKGVLDVKDVEEGNVEETNSEETHQKDG 315 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +1 Query: 106 SNVVEPRSGEFRSTVAFKVVATGSIEPGSSEVLWCRDG 219 ++++ P EF+ + K V G++E +SE +DG Sbjct: 193 NDILRPYVPEFKGVLDVKDVEEGNVEETNSEETHQKDG 230 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 24.2 bits (50), Expect = 1.2 Identities = 11/38 (28%), Positives = 21/38 (55%) Frame = +1 Query: 106 SNVVEPRSGEFRSTVAFKVVATGSIEPGSSEVLWCRDG 219 ++++ P EF+ + K V G++E +SE +DG Sbjct: 512 NDILRPYVPEFKGVLDVKDVEEGNVEETNSEETHQKDG 549 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.4 bits (43), Expect = 8.6 Identities = 12/38 (31%), Positives = 18/38 (47%) Frame = -2 Query: 318 IISLKNQHKVRYK*ILDNDRLLQKELTNRKIATTVTTP 205 I S K Q K K I D+ ++ + + TT+ TP Sbjct: 805 ISSRKEQKKSEEKNINDHCVTTEQSVVVTNVTTTINTP 842 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 186,701 Number of Sequences: 438 Number of extensions: 3846 Number of successful extensions: 5 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21683070 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -