BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30466 (539 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_29066| Best HMM Match : No HMM Matches (HMM E-Value=.) 137 5e-33 SB_27203| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 28 5.6 SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.4 >SB_29066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 212 Score = 137 bits (332), Expect = 5e-33 Identities = 60/66 (90%), Positives = 64/66 (96%) Frame = +2 Query: 248 LENMIIVPEMVGSIVGIYNGKTFNQVEIKPEMIGHYLGEFSVTYKPVKHGRPGIGATHSS 427 L NMIIVPEM+GS+VG+YNGKTF QVEIKPEMIGHYLGEFS+TYKPVKHGRPGIGATHSS Sbjct: 84 LRNMIIVPEMIGSVVGVYNGKTFTQVEIKPEMIGHYLGEFSITYKPVKHGRPGIGATHSS 143 Query: 428 RFIPLK 445 RFIPLK Sbjct: 144 RFIPLK 149 Score = 112 bits (269), Expect = 2e-25 Identities = 53/79 (67%), Positives = 63/79 (79%) Frame = +3 Query: 18 DETLKKKRIFRKFTYRGVDLDQLLDMPNEQLMELMHXXXXXXXXXGLKRKPMALVKKLRR 197 D +K+KR FRKFTYRGVDLDQLLD+ +EQLMEL+ GLKRKP+AL+K+LR+ Sbjct: 7 DAQIKRKRTFRKFTYRGVDLDQLLDLSHEQLMELVCCRQRRRFTRGLKRKPLALMKRLRK 66 Query: 198 AKKEAPPNEKPEIVKTHLR 254 AKKEA P EKPE+VKTHLR Sbjct: 67 AKKEAAPMEKPEVVKTHLR 85 >SB_27203| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 527 Score = 27.9 bits (59), Expect = 5.6 Identities = 19/49 (38%), Positives = 24/49 (48%) Frame = +1 Query: 19 TKPSRKSVFSGSSLTGELISISSLICPMSNSWN*CMPVRAGGSLVVLNV 165 TKP S SGS+ G L SS C S+S + + V GG + V V Sbjct: 179 TKPDAMSASSGSASAGRLYGNSSW-CSTSSSVSEYLQVDLGGVMTVSGV 226 >SB_29854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3235 Score = 27.5 bits (58), Expect = 7.4 Identities = 12/38 (31%), Positives = 21/38 (55%) Frame = +2 Query: 326 EIKPEMIGHYLGEFSVTYKPVKHGRPGIGATHSSRFIP 439 ++KP++ + G ++V Y P K GR I + R +P Sbjct: 1714 DLKPDVKDNGDGTYTVAYVPDKPGRYNIDVKYGDRRVP 1751 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,192,365 Number of Sequences: 59808 Number of extensions: 285327 Number of successful extensions: 551 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 501 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 551 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1227799733 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -