BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30465 (766 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|S... 28 1.3 SPAC4F10.02 |||aminopeptidase |Schizosaccharomyces pombe|chr 1||... 26 5.1 SPAC19A8.15 |trp2||tryptophan synthase|Schizosaccharomyces pombe... 25 9.0 >SPAC1527.01 |mok11|SPAC23D3.15|alpha-1,3-glucan synthase Mok11|Schizosaccharomyces pombe|chr 1|||Manual Length = 2397 Score = 28.3 bits (60), Expect = 1.3 Identities = 21/50 (42%), Positives = 24/50 (48%), Gaps = 3/50 (6%) Frame = +3 Query: 198 LSNRSFRYRVEGTRSSPRPSQLESRKALSSHP---SYLAYSLTIFPGRRR 338 L N SF RV PS LE HP SYL++S+T P RRR Sbjct: 1014 LQNNSFLSRVS-------PSSLEENVFYIQHPPPKSYLSWSVTFDPQRRR 1056 >SPAC4F10.02 |||aminopeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 467 Score = 26.2 bits (55), Expect = 5.1 Identities = 14/49 (28%), Positives = 27/49 (55%) Frame = -3 Query: 227 DSISKRAVRQEVPYDEHETIRHTHVE*FENQTVVPDFVERFCDVEEESS 81 +S+ + + VP +HE I + E+ T +P ++R C++ +ESS Sbjct: 275 NSLDNESCVRVVPSFDHEEIGSVSAQGAES-TFLPAVLQRICELGKESS 322 >SPAC19A8.15 |trp2||tryptophan synthase|Schizosaccharomyces pombe|chr 1|||Manual Length = 697 Score = 25.4 bits (53), Expect = 9.0 Identities = 9/19 (47%), Positives = 15/19 (78%) Frame = +1 Query: 697 PMICKRSKMSLRNKVTLYK 753 P ICK ++++L+N +TL K Sbjct: 63 PTICKGNEIALKNNITLEK 81 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,331,022 Number of Sequences: 5004 Number of extensions: 73416 Number of successful extensions: 190 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 183 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 190 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 367316502 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -