BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30465 (766 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF629347-1|ABR15764.1| 1998|Homo sapiens Nav1.5 Na+ channel prot... 34 0.64 EF629346-1|ABR15763.1| 2016|Homo sapiens Nav1.5 Na+ channel prot... 34 0.64 EF179185-1|ABN05288.1| 2015|Homo sapiens sodium channel, voltage... 34 0.64 DQ784809-1|ABQ01244.1| 2016|Homo sapiens sodium channel protein ... 34 0.64 AY148488-1|AAN61120.1| 2015|Homo sapiens cardiac sodium channel ... 34 0.64 AB208866-1|BAD92103.1| 1576|Homo sapiens voltage-gated sodium ch... 34 0.64 AB158470-1|BAD12085.1| 1962|Homo sapiens TTX-resistant sodium ch... 34 0.64 AB158469-1|BAD12084.1| 2016|Homo sapiens TTX-resistant sodium ch... 34 0.64 X04393-1|CAA27981.1| 545|Homo sapiens complement C8-beta propet... 33 1.1 M16973-1|AAA51862.1| 591|Homo sapiens C8B protein. 33 1.1 BC130575-1|AAI30576.1| 591|Homo sapiens complement component 8,... 33 1.1 AL121998-1|CAC18532.1| 591|Homo sapiens complement component 8,... 33 1.1 U93563-1|AAC51261.1| 1275|Homo sapiens putative p150 protein. 31 3.4 AK131259-1|BAD18437.1| 512|Homo sapiens protein. 31 3.4 AK127459-1|BAC86988.1| 238|Homo sapiens protein ( Homo sapiens ... 31 3.4 X03145-4|CAA26918.1| 140|Homo sapiens protein ( Human KpnI repe... 31 6.0 M77235-1|AAA58644.1| 2016|Homo sapiens sodium channel alpha subu... 31 6.0 BX928748-1|CAH74051.1| 5635|Homo sapiens protein ( Human DNA seq... 31 6.0 AY038064-1|AAK74065.1| 2015|Homo sapiens voltage-gated sodium ch... 31 6.0 AL391824-1|CAI17865.1| 5635|Homo sapiens protein ( Human DNA seq... 31 6.0 AL135797-1|CAI17871.1| 5635|Homo sapiens protein ( Human DNA seq... 31 6.0 AL135796-1|CAI17854.1| 5635|Homo sapiens protein ( Human DNA seq... 31 6.0 AL133553-2|CAI17858.1| 5635|Homo sapiens protein ( Human DNA seq... 31 6.0 AL133515-1|CAI17853.1| 5635|Homo sapiens protein ( Human DNA seq... 31 6.0 AL121996-1|CAI17844.1| 5635|Homo sapiens protein ( Human DNA seq... 31 6.0 AL118512-1|CAI17864.1| 5635|Homo sapiens protein ( Human DNA seq... 31 6.0 AK027344-1|BAB55049.1| 741|Homo sapiens protein ( Homo sapiens ... 31 6.0 AJ306906-1|CAC37630.1| 2673|Homo sapiens fibulin-6 protein. 31 6.0 AF482988-1|AAO91669.1| 2015|Homo sapiens cardiac sodium channel ... 31 6.0 AF156100-1|AAK68690.1| 5636|Homo sapiens hemicentin protein. 31 6.0 AY507106-1|AAS87020.1| 1043|Homo sapiens NMDA receptor subunit 3... 30 7.9 AY435145-1|AAR95646.1| 402|Homo sapiens I-branching beta-1,6-ac... 30 7.9 AL833902-1|CAD38758.1| 545|Homo sapiens hypothetical protein pr... 30 7.9 AL139039-2|CAH73009.1| 226|Homo sapiens protein ( Human DNA seq... 30 7.9 AK090483-1|BAC03464.1| 402|Homo sapiens FLJ00405 protein protein. 30 7.9 AK000407-1|BAA91144.1| 310|Homo sapiens protein ( Homo sapiens ... 30 7.9 AF525164-1|AAQ08897.1| 524|Homo sapiens DERPC protein. 30 7.9 AF458024-1|AAM73864.1| 402|Homo sapiens I beta-1,6-N-acetylgluc... 30 7.9 AB078432-1|BAC66781.1| 401|Homo sapiens beta-1,6-N-acetylglucos... 30 7.9 >EF629347-1|ABR15764.1| 1998|Homo sapiens Nav1.5 Na+ channel protein. Length = 1998 Score = 33.9 bits (74), Expect = 0.64 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 113 RQSLAQRFDFQTIQHGCAG*SRAHHTGLLVE-PLFSISSRGNP 238 R+ L DF ++ AG S +HHT LLV PL S++G P Sbjct: 534 RRDLGSEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQP 576 >EF629346-1|ABR15763.1| 2016|Homo sapiens Nav1.5 Na+ channel protein. Length = 2016 Score = 33.9 bits (74), Expect = 0.64 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 113 RQSLAQRFDFQTIQHGCAG*SRAHHTGLLVE-PLFSISSRGNP 238 R+ L DF ++ AG S +HHT LLV PL S++G P Sbjct: 534 RRDLGSEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQP 576 >EF179185-1|ABN05288.1| 2015|Homo sapiens sodium channel, voltage-gated, type V, alpha (long QT syndrome 3) protein. Length = 2015 Score = 33.9 bits (74), Expect = 0.64 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 113 RQSLAQRFDFQTIQHGCAG*SRAHHTGLLVE-PLFSISSRGNP 238 R+ L DF ++ AG S +HHT LLV PL S++G P Sbjct: 534 RRDLGSEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQP 576 >DQ784809-1|ABQ01244.1| 2016|Homo sapiens sodium channel protein type V alpha subunit protein. Length = 2016 Score = 33.9 bits (74), Expect = 0.64 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 113 RQSLAQRFDFQTIQHGCAG*SRAHHTGLLVE-PLFSISSRGNP 238 R+ L DF ++ AG S +HHT LLV PL S++G P Sbjct: 534 RRDLGSEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQP 576 >AY148488-1|AAN61120.1| 2015|Homo sapiens cardiac sodium channel alpha subunit Nav1.5 protein. Length = 2015 Score = 33.9 bits (74), Expect = 0.64 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 113 RQSLAQRFDFQTIQHGCAG*SRAHHTGLLVE-PLFSISSRGNP 238 R+ L DF ++ AG S +HHT LLV PL S++G P Sbjct: 534 RRDLGSEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQP 576 >AB208866-1|BAD92103.1| 1576|Homo sapiens voltage-gated sodium channel type V alpha isoform b variant protein. Length = 1576 Score = 33.9 bits (74), Expect = 0.64 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 113 RQSLAQRFDFQTIQHGCAG*SRAHHTGLLVE-PLFSISSRGNP 238 R+ L DF ++ AG S +HHT LLV PL S++G P Sbjct: 113 RRDLGSEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQP 155 >AB158470-1|BAD12085.1| 1962|Homo sapiens TTX-resistant sodium channel splicing variant protein. Length = 1962 Score = 33.9 bits (74), Expect = 0.64 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 113 RQSLAQRFDFQTIQHGCAG*SRAHHTGLLVE-PLFSISSRGNP 238 R+ L DF ++ AG S +HHT LLV PL S++G P Sbjct: 534 RRDLGSEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQP 576 >AB158469-1|BAD12084.1| 2016|Homo sapiens TTX-resistant sodium channel protein. Length = 2016 Score = 33.9 bits (74), Expect = 0.64 Identities = 18/43 (41%), Positives = 24/43 (55%), Gaps = 1/43 (2%) Frame = +2 Query: 113 RQSLAQRFDFQTIQHGCAG*SRAHHTGLLVE-PLFSISSRGNP 238 R+ L DF ++ AG S +HHT LLV PL S++G P Sbjct: 534 RRDLGSEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQP 576 >X04393-1|CAA27981.1| 545|Homo sapiens complement C8-beta propetide /map='1p36.2- p22.1'on) protein. Length = 545 Score = 33.1 bits (72), Expect = 1.1 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 579 GLTKESNRGCEIPPPNTGGNPCGAP 505 G K R C PPP GG+PC P Sbjct: 513 GRRKTRQRQCNNPPPQNGGSPCSGP 537 >M16973-1|AAA51862.1| 591|Homo sapiens C8B protein. Length = 591 Score = 33.1 bits (72), Expect = 1.1 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 579 GLTKESNRGCEIPPPNTGGNPCGAP 505 G K R C PPP GG+PC P Sbjct: 559 GRRKTRQRQCNNPPPQNGGSPCSGP 583 >BC130575-1|AAI30576.1| 591|Homo sapiens complement component 8, beta polypeptide protein. Length = 591 Score = 33.1 bits (72), Expect = 1.1 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 579 GLTKESNRGCEIPPPNTGGNPCGAP 505 G K R C PPP GG+PC P Sbjct: 559 GRRKTRQRQCNNPPPQNGGSPCSGP 583 >AL121998-1|CAC18532.1| 591|Homo sapiens complement component 8, beta polypeptide protein. Length = 591 Score = 33.1 bits (72), Expect = 1.1 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -2 Query: 579 GLTKESNRGCEIPPPNTGGNPCGAP 505 G K R C PPP GG+PC P Sbjct: 559 GRRKTRQRQCNNPPPQNGGSPCSGP 583 >U93563-1|AAC51261.1| 1275|Homo sapiens putative p150 protein. Length = 1275 Score = 31.5 bits (68), Expect = 3.4 Identities = 20/89 (22%), Positives = 38/89 (42%) Frame = +3 Query: 27 RLTEHILVGLNRPKPLYTGALFFDVAKAFDKVWHNGLIFKLFNMGVPDSLVLIIRDFLSN 206 R + +++ +NR K + D KAFDK+ ++ L +G+ + IIR Sbjct: 577 RKSINVIQHINRAKDKNHMIISIDAEKAFDKIQQPFMLKTLNKLGIDGTYFKIIRAIYDK 636 Query: 207 RSFRYRVEGTRSSPRPSQLESRKALSSHP 293 + R+ G + P + +R+ P Sbjct: 637 PTANIRLNGQKLEAFPLKTGTRQGCPLSP 665 >AK131259-1|BAD18437.1| 512|Homo sapiens protein. Length = 512 Score = 31.5 bits (68), Expect = 3.4 Identities = 24/53 (45%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -1 Query: 163 TPMLNSLKIKPLCQTLSNAFA-TSKKRAPVYNGFGRLSPTRMCSVRRCTC*TH 8 TP L SL K Q +S A A +S KR Y+ + LS T CSV RC TH Sbjct: 21 TPFL-SLPPKVANQPMSAAAAGSSLKRQLSYSRYLALSSTNTCSVCRCLSLTH 72 >AK127459-1|BAC86988.1| 238|Homo sapiens protein ( Homo sapiens cDNA FLJ45551 fis, clone BRTHA2037247. ). Length = 238 Score = 31.5 bits (68), Expect = 3.4 Identities = 19/80 (23%), Positives = 34/80 (42%) Frame = +3 Query: 54 LNRPKPLYTGALFFDVAKAFDKVWHNGLIFKLFNMGVPDSLVLIIRDFLSNRSFRYRVEG 233 +NR K + D KAF+K+ H ++ L +G+ + IIR R+ + G Sbjct: 17 INRTKDKNHMIISIDAEKAFNKIQHRFMLKTLNKLGIEGPCLKIIRAICDKRTANIILNG 76 Query: 234 TRSSPRPSQLESRKALSSHP 293 + P + +R+ P Sbjct: 77 QQLEAFPLKTGTRQGCPLSP 96 >X03145-4|CAA26918.1| 140|Homo sapiens protein ( Human KpnI repetitive sequence (T-betaG41) 3kb downstream of beta-globin gene. ). Length = 140 Score = 30.7 bits (66), Expect = 6.0 Identities = 22/99 (22%), Positives = 42/99 (42%), Gaps = 2/99 (2%) Frame = +3 Query: 3 HSCVQQV--HRLTEHILVGLNRPKPLYTGALFFDVAKAFDKVWHNGLIFKLFNMGVPDSL 176 H C ++ H + +I+ +NR K + D KAFDK+ ++ L +G+ + Sbjct: 5 HPCHARLVQHTKSINIIQHINRTKDTNHMIISIDAEKAFDKIQQCFMLKTLNKLGIDGTY 64 Query: 177 VLIIRDFLSNRSFRYRVEGTRSSPRPSQLESRKALSSHP 293 + IIR + + G + P + +R+ P Sbjct: 65 LKIIRAIYDKPTANIILSGQKLEAFPLKTGTRQGCPLSP 103 >M77235-1|AAA58644.1| 2016|Homo sapiens sodium channel alpha subunit protein. Length = 2016 Score = 30.7 bits (66), Expect = 6.0 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 113 RQSLAQRFDFQTIQHGCAG*SRAHHTGLLVE-PLFSISSRGNP 238 R+ L DF ++ A S +HHT LLV PL S++G P Sbjct: 534 RRDLGSEADFADDENSTARESESHHTSLLVPWPLRRTSAQGQP 576 >BX928748-1|CAH74051.1| 5635|Homo sapiens protein ( Human DNA sequence from clone RP11-465I11 on chromosome 1 Contains part of the gene for hemicentin (FIBL-6). ). Length = 5635 Score = 30.7 bits (66), Expect = 6.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 558 RGCEIPPPNTGGNPCGAP 505 R C+ PPP+ GG CG P Sbjct: 4782 RTCDNPPPSNGGRACGGP 4799 >AY038064-1|AAK74065.1| 2015|Homo sapiens voltage-gated sodium channel type V alpha subunit jejunal variant protein. Length = 2015 Score = 30.7 bits (66), Expect = 6.0 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 113 RQSLAQRFDFQTIQHGCAG*SRAHHTGLLVE-PLFSISSRGNP 238 R+ L DF ++ A S +HHT LLV PL S++G P Sbjct: 534 RRDLGSEADFADDENSTARESESHHTSLLVPWPLRRTSAQGQP 576 >AL391824-1|CAI17865.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-268N14 on chromosome 1 Contains part of the gene for hemicentin. ). Length = 5635 Score = 30.7 bits (66), Expect = 6.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 558 RGCEIPPPNTGGNPCGAP 505 R C+ PPP+ GG CG P Sbjct: 4782 RTCDNPPPSNGGRACGGP 4799 >AL135797-1|CAI17871.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-77J13 on chromosome 1 Contains part of the gene for hemicentin. ). Length = 5635 Score = 30.7 bits (66), Expect = 6.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 558 RGCEIPPPNTGGNPCGAP 505 R C+ PPP+ GG CG P Sbjct: 4782 RTCDNPPPSNGGRACGGP 4799 >AL135796-1|CAI17854.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-164L12 on chromosome 1 Contains part of the gene for hemicentin. ). Length = 5635 Score = 30.7 bits (66), Expect = 6.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 558 RGCEIPPPNTGGNPCGAP 505 R C+ PPP+ GG CG P Sbjct: 4782 RTCDNPPPSNGGRACGGP 4799 >AL133553-2|CAI17858.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-174L6 on chromosome 1 Contains the3' end of the gene for hemicentin, the PRG4 gene for proteoglycan 4 ). Length = 5635 Score = 30.7 bits (66), Expect = 6.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 558 RGCEIPPPNTGGNPCGAP 505 R C+ PPP+ GG CG P Sbjct: 4782 RTCDNPPPSNGGRACGGP 4799 >AL133515-1|CAI17853.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-153O3 on chromosome 1 Contains part of the gene for hemicentin. ). Length = 5635 Score = 30.7 bits (66), Expect = 6.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 558 RGCEIPPPNTGGNPCGAP 505 R C+ PPP+ GG CG P Sbjct: 4782 RTCDNPPPSNGGRACGGP 4799 >AL121996-1|CAI17844.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-118G19 on chromosome 1q25.1-31.1 Contains the 5' end of the gene for hemicentin. ). Length = 5635 Score = 30.7 bits (66), Expect = 6.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 558 RGCEIPPPNTGGNPCGAP 505 R C+ PPP+ GG CG P Sbjct: 4782 RTCDNPPPSNGGRACGGP 4799 >AL118512-1|CAI17864.1| 5635|Homo sapiens protein ( Human DNA sequence from clone GS1-248A21 on chromosome 1q31.1-31.3 Contains part of the gene for hemicentin (FIBL-6). ). Length = 5635 Score = 30.7 bits (66), Expect = 6.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 558 RGCEIPPPNTGGNPCGAP 505 R C+ PPP+ GG CG P Sbjct: 4782 RTCDNPPPSNGGRACGGP 4799 >AK027344-1|BAB55049.1| 741|Homo sapiens protein ( Homo sapiens cDNA FLJ14438 fis, clone HEMBB1000317, weakly similar to FIBULIN-1, ISOFORM D PRECURSOR. ). Length = 741 Score = 30.7 bits (66), Expect = 6.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 558 RGCEIPPPNTGGNPCGAP 505 R C+ PPP+ GG CG P Sbjct: 5 RTCDNPPPSNGGRACGGP 22 >AJ306906-1|CAC37630.1| 2673|Homo sapiens fibulin-6 protein. Length = 2673 Score = 30.7 bits (66), Expect = 6.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 558 RGCEIPPPNTGGNPCGAP 505 R C+ PPP+ GG CG P Sbjct: 1820 RTCDNPPPSNGGRACGGP 1837 >AF482988-1|AAO91669.1| 2015|Homo sapiens cardiac sodium channel alpha subunit protein. Length = 2015 Score = 30.7 bits (66), Expect = 6.0 Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 1/43 (2%) Frame = +2 Query: 113 RQSLAQRFDFQTIQHGCAG*SRAHHTGLLVE-PLFSISSRGNP 238 R+ L DF ++ AG S +H T LLV PL S++G P Sbjct: 534 RRDLGSEADFADDENSTAGESESHRTSLLVPWPLRRTSAQGQP 576 >AF156100-1|AAK68690.1| 5636|Homo sapiens hemicentin protein. Length = 5636 Score = 30.7 bits (66), Expect = 6.0 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 558 RGCEIPPPNTGGNPCGAP 505 R C+ PPP+ GG CG P Sbjct: 4783 RTCDNPPPSNGGRACGGP 4800 >AY507106-1|AAS87020.1| 1043|Homo sapiens NMDA receptor subunit 3B protein. Length = 1043 Score = 30.3 bits (65), Expect = 7.9 Identities = 16/51 (31%), Positives = 24/51 (47%) Frame = -2 Query: 342 WVGGDRGISLTNKLNRRGERTEPCGTPAVKVVGRSGFPRLDIEKSGSTRSP 190 WV G + ++ L R +P G PA VG +LD+E G++ P Sbjct: 355 WVTGSSQVHMSRHLKVWSLRRDPRGAPAWATVGSWRDGQLDLEPGGASAWP 405 >AY435145-1|AAR95646.1| 402|Homo sapiens I-branching beta-1,6-acetylglucosaminyltransferase family polypeptide 1 protein. Length = 402 Score = 30.3 bits (65), Expect = 7.9 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -1 Query: 139 IKPLCQTLSNAFATSKKRAPVYNGFGRLSPTRMC 38 +K L NAF SKK + VY G RL C Sbjct: 140 VKQLLSCFPNAFLASKKESVVYGGISRLQADLNC 173 >AL833902-1|CAD38758.1| 545|Homo sapiens hypothetical protein protein. Length = 545 Score = 30.3 bits (65), Expect = 7.9 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = +2 Query: 512 PHGFPPVLGGGISHPRLLSLVNPYPGPG---RSSTWALP 619 P G P G +S PR L+ P PGPG T ALP Sbjct: 120 PRGMNPTGTGAVSFPRPGGLLGPGPGPGPTLNPRTGALP 158 >AL139039-2|CAH73009.1| 226|Homo sapiens protein ( Human DNA sequence from clone RP11-360O19 on chromosome 6 Contains anovel gene, a glucosaminyl (N-acetyl) transferase 1 core 2 ). Length = 226 Score = 30.3 bits (65), Expect = 7.9 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -1 Query: 139 IKPLCQTLSNAFATSKKRAPVYNGFGRLSPTRMC 38 +K L NAF SKK + VY G RL C Sbjct: 58 VKQLLSCFPNAFLASKKESVVYGGISRLQADLNC 91 >AK090483-1|BAC03464.1| 402|Homo sapiens FLJ00405 protein protein. Length = 402 Score = 30.3 bits (65), Expect = 7.9 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -1 Query: 139 IKPLCQTLSNAFATSKKRAPVYNGFGRLSPTRMC 38 +K L NAF SKK + VY G RL C Sbjct: 140 VKQLLSCFPNAFLASKKESVVYGGISRLQADLNC 173 >AK000407-1|BAA91144.1| 310|Homo sapiens protein ( Homo sapiens cDNA FLJ20400 fis, clone KAT00587. ). Length = 310 Score = 30.3 bits (65), Expect = 7.9 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = +2 Query: 512 PHGFPPVLGGGISHPRLLSLVNPYPGPG---RSSTWALP 619 P G P G +S PR L+ P PGPG T ALP Sbjct: 99 PRGMNPTGTGAVSFPRPGGLLGPGPGPGPTLNPRTGALP 137 >AF525164-1|AAQ08897.1| 524|Homo sapiens DERPC protein. Length = 524 Score = 30.3 bits (65), Expect = 7.9 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 3/39 (7%) Frame = +2 Query: 512 PHGFPPVLGGGISHPRLLSLVNPYPGPG---RSSTWALP 619 P G P G +S PR L+ P PGPG T ALP Sbjct: 99 PRGMNPTGTGAVSFPRPGGLLGPGPGPGPTLNPRTGALP 137 >AF458024-1|AAM73864.1| 402|Homo sapiens I beta-1,6-N-acetylglucosaminyltransferase A form protein. Length = 402 Score = 30.3 bits (65), Expect = 7.9 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -1 Query: 139 IKPLCQTLSNAFATSKKRAPVYNGFGRLSPTRMC 38 +K L NAF SKK + VY G RL C Sbjct: 140 VKQLLSCFPNAFLASKKESVVYGGISRLQADLNC 173 >AB078432-1|BAC66781.1| 401|Homo sapiens beta-1,6-N-acetylglucosaminyltransferase 2 protein. Length = 401 Score = 30.3 bits (65), Expect = 7.9 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = -1 Query: 139 IKPLCQTLSNAFATSKKRAPVYNGFGRLSPTRMC 38 +K L NAF SKK + VY G RL C Sbjct: 139 VKQLLSCFPNAFLASKKESVVYGGISRLQADLNC 172 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 124,533,939 Number of Sequences: 237096 Number of extensions: 3080164 Number of successful extensions: 11981 Number of sequences better than 10.0: 39 Number of HSP's better than 10.0 without gapping: 11291 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11981 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 9199990470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -