BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30463 (846 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 24 1.5 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 2.0 Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP... 23 3.5 AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protei... 23 4.7 L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein pro... 22 6.2 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 24.2 bits (50), Expect = 1.5 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = -2 Query: 428 PLATVINM*QHLTAALRPCPCVDVTSPTSYRRDN 327 P+AT Q LRP D TSP YR N Sbjct: 397 PMATTSPQSQSTIQTLRPQVSPDRTSPMEYRLYN 430 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.8 bits (49), Expect = 2.0 Identities = 9/26 (34%), Positives = 13/26 (50%) Frame = -1 Query: 516 RWHRHQDMTAAGNRHQHGTTAGNRHQ 439 RW ++QD +G R TA H+ Sbjct: 45 RWKQYQDTLYSGTRSSESLTAQAHHR 70 >Z26318-1|CAA81227.1| 544|Apis mellifera royal jelly protein RJP57-1 protein. Length = 544 Score = 23.0 bits (47), Expect = 3.5 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = -1 Query: 510 HRHQDMTAAGNRHQHGTTAGNRHQHGTTAGNR 415 +R D GNR GNR GNR Sbjct: 463 NRQNDNKQNGNRQNDNKQNGNRQNDNKQNGNR 494 >AF469010-1|AAL93136.1| 678|Apis mellifera cGMP-dependent protein kinase foraging protein. Length = 678 Score = 22.6 bits (46), Expect = 4.7 Identities = 10/30 (33%), Positives = 15/30 (50%) Frame = -2 Query: 836 LQM*FSDGRQPDDDERHPRDILTHHRDKTI 747 L++ F R P + PRD HR K++ Sbjct: 48 LKLAFEPRRNPGPGSKGPRDFPRSHRFKSL 77 >L01587-1|AAA27734.1| 69|Apis mellifera zinc finger protein protein. Length = 69 Score = 22.2 bits (45), Expect = 6.2 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 691 HLFTH*GNKRIKVDVCIYS 635 HL H G+K K + C YS Sbjct: 7 HLRNHFGSKPFKCEKCSYS 25 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 230,804 Number of Sequences: 438 Number of extensions: 5293 Number of successful extensions: 24 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 24 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27188448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -