BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30459 (754 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 22 6.0 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 21 8.0 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 21 8.0 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 21 8.0 AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholo... 21 8.0 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 21.8 bits (44), Expect = 6.0 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = +2 Query: 419 SMKSTMEDEKLKEKISDSD 475 S+ S EDE+++ ++SD D Sbjct: 18 SLLSKKEDEEVEHRLSDRD 36 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.4 bits (43), Expect = 8.0 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -1 Query: 625 LLRHPGTSS*LSDCKCLPILSACAHTPPCRPAGWNP 518 +L+ P T D K LP H PP P G NP Sbjct: 720 MLQSPLTPHEAFDVK-LPPPPHPHHQPPRNPVGTNP 754 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.4 bits (43), Expect = 8.0 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -1 Query: 625 LLRHPGTSS*LSDCKCLPILSACAHTPPCRPAGWNP 518 +L+ P T D K LP H PP P G NP Sbjct: 612 MLQSPLTPHEAFDVK-LPPPPHPHHQPPRNPVGTNP 646 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.4 bits (43), Expect = 8.0 Identities = 11/28 (39%), Positives = 15/28 (53%) Frame = -3 Query: 161 QLEFTEQVVIFGHSTLTLKYLDEYSGLV 78 Q +QV F HS ++ +L E GLV Sbjct: 362 QYVMQQQVKNFRHSVRSVFFLSEIFGLV 389 >AF219117-1|AAF71999.1| 406|Tribolium castaneum tailless ortholog protein. Length = 406 Score = 21.4 bits (43), Expect = 8.0 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +2 Query: 662 PEPEVPPPGLEALAPPS 712 P P+VPP L + PP+ Sbjct: 176 PLPQVPPLPLPPIFPPT 192 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,239 Number of Sequences: 336 Number of extensions: 3408 Number of successful extensions: 10 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20131186 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -