BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30459 (754 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide recepto... 30 0.088 AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-tran... 26 1.1 AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeot... 26 1.4 AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical prot... 24 5.8 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 23 7.7 >AY299455-1|AAQ73620.1| 493|Anopheles gambiae FMRF amide receptor protein. Length = 493 Score = 29.9 bits (64), Expect = 0.088 Identities = 19/48 (39%), Positives = 20/48 (41%) Frame = +2 Query: 539 TRRSMSTSRKNWKAFTIR*LRRCTRVPEESPEVCRASRAEHPEPEVPP 682 T RS ST N TIR R TR P P V +R P PP Sbjct: 416 TTRSTSTKLSNCSMRTIRTTVRSTRAPSPGPIVYYPARETLPRLAQPP 463 >AF316638-1|AAG45166.1| 211|Anopheles gambiae glutathione S-transferase D12 protein. Length = 211 Score = 26.2 bits (55), Expect = 1.1 Identities = 17/88 (19%), Positives = 34/88 (38%) Frame = +2 Query: 233 PQRFRYRESTNKENKITITNDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALESY 412 P F + N ++ I D G + E ++ AEKY +D + + ++ + Sbjct: 36 PADFEVLKKVNPQHTIPTLVDNGHILWESYAILIYLAEKYALDDSLYPKDVCERSIVHQR 95 Query: 413 CFSMKSTMEDEKLKEKISDSDKQTILDK 496 F ++ L+ +S I D+ Sbjct: 96 LFFDSGMFQNTTLQAVLSHLRNNPITDE 123 >AF080566-1|AAC31946.1| 308|Anopheles gambiae abdominal-A homeotic protein protein. Length = 308 Score = 25.8 bits (54), Expect = 1.4 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = +2 Query: 290 NDKGRLSKEEIERMVNEAEKYRNEDDKQKETIQAKNALES 409 N++ R +EE ++M NE+ K + QK+ Q + S Sbjct: 204 NEQARREREEQDKMKNESLKSAQQHHSQKQAQQEHTVVGS 243 >AJ439060-18|CAD27769.1| 257|Anopheles gambiae hypothetical protein protein. Length = 257 Score = 23.8 bits (49), Expect = 5.8 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 599 RRCTRVPEESPEVCRASRAEHPEPEVPPP 685 R+C+R SP+ A ++++ P VPPP Sbjct: 44 RKCSR--NGSPKFAPAVQSKNRMPPVPPP 70 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.4 bits (48), Expect = 7.7 Identities = 10/29 (34%), Positives = 14/29 (48%) Frame = +2 Query: 641 RASRAEHPEPEVPPPGLEALAPPSRRSIK 727 R H +VPPPG+E P + I+ Sbjct: 1740 RMEEGAHLSFKVPPPGIEFTLPSPKIGIE 1768 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 712,566 Number of Sequences: 2352 Number of extensions: 14802 Number of successful extensions: 52 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 52 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 52 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -