BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30459 (754 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 25 0.58 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 25 0.58 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 25 0.58 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 25 0.58 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 25 0.58 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 25 0.58 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 23 3.1 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 23 3.1 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 23 3.1 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 23 3.1 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 23 3.1 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 23 3.1 AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex det... 23 3.1 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 22 5.4 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 22 5.4 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 22 5.4 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 22 5.4 AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex det... 22 7.1 AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex det... 22 7.1 AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex det... 22 7.1 AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex det... 22 7.1 AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex det... 22 7.1 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 7.1 AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor p... 21 9.4 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 9.4 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 21 9.4 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.4 bits (53), Expect = 0.58 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAY 330 SR H HY R+RS + R+R Y Sbjct: 219 SRTHGFQHTSSHYSRERSCSRDRNREY 245 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.4 bits (53), Expect = 0.58 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAY 330 SR H HY R+RS + R+R Y Sbjct: 219 SRTHGFQHTSSHYSRERSCSRDRNREY 245 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.4 bits (53), Expect = 0.58 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAY 330 SR H HY R+RS + R+R Y Sbjct: 219 SRTHGFQHTSSHYSRERSCSRDRNREY 245 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.4 bits (53), Expect = 0.58 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAY 330 SR H HY R+RS + R+R Y Sbjct: 219 SRTHGFQHTSSHYSRERSCSRDRNREY 245 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 25.4 bits (53), Expect = 0.58 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAY 330 SR H HY R+RS + R+R Y Sbjct: 208 SRTHGFQHTSSHYSRERSCSRDRNREY 234 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 25.4 bits (53), Expect = 0.58 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAY 330 SR H HY R+RS + R+R Y Sbjct: 219 SRTHGFQHTSSHYSRERSCSRDRNREY 245 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 23.0 bits (47), Expect = 3.1 Identities = 9/14 (64%), Positives = 10/14 (71%) Frame = +1 Query: 70 TLITNPEYSSKYLR 111 T I N YSSKY+R Sbjct: 199 TYIVNTNYSSKYMR 212 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAYG**GREVQK 357 SR H Y R+RS + R+R Y R+ +K Sbjct: 208 SRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEK 243 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAYG**GREVQK 357 SR H Y R+RS + R+R Y R+ +K Sbjct: 219 SRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEK 254 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAYG**GREVQK 357 SR H Y R+RS + R+R Y R+ +K Sbjct: 219 SRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEK 254 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAYG**GREVQK 357 SR H Y R+RS + R+R Y R+ +K Sbjct: 219 SRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEK 254 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/36 (33%), Positives = 17/36 (47%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAYG**GREVQK 357 SR H Y R+RS + R+R Y R+ +K Sbjct: 219 SRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEK 254 >AY350617-1|AAQ57659.1| 428|Apis mellifera complementary sex determiner protein. Length = 428 Score = 23.0 bits (47), Expect = 3.1 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAY 330 SR H Y R+RS + R+R Y Sbjct: 219 SRTHDFQHTSSRYSRERSCSRDRNREY 245 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAY 330 SR H Y R+RS + R+R Y Sbjct: 208 SRTHGFQHTSSRYSRERSCSRDRNREY 234 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAY 330 SR H Y R+RS + R+R Y Sbjct: 219 SRTHGFQHTSSRYSRERSCSRDRNREY 245 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAY 330 SR H Y R+RS + R+R Y Sbjct: 219 SRTHGFQHTSSRYSRERSCSRDRNREY 245 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 22.2 bits (45), Expect = 5.4 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAY 330 SR H Y R+RS + R+R Y Sbjct: 219 SRTHGFQHTSSRYSRERSCSRDRNREY 245 >AY569703-1|AAS86656.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAYG**GREVQK 357 +R H Y R+RS + R+R Y R+ +K Sbjct: 208 NRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEK 243 >AY569701-1|AAS86654.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAYG**GREVQK 357 +R H Y R+RS + R+R Y R+ +K Sbjct: 219 NRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEK 254 >AY569700-1|AAS86653.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAYG**GREVQK 357 +R H Y R+RS + R+R Y R+ +K Sbjct: 219 NRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEK 254 >AY569699-1|AAS86652.1| 396|Apis mellifera complementary sex determiner protein. Length = 396 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAYG**GREVQK 357 +R H Y R+RS + R+R Y R+ +K Sbjct: 208 NRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEK 243 >AY569694-1|AAS86647.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.8 bits (44), Expect = 7.1 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 250 SRVHQQGEQDHHYQRQRSSLQGRDRAYG**GREVQK 357 +R H Y R+RS + R+R Y R+ +K Sbjct: 208 NRTHGFQHTSSRYSRERSCSRDRNREYRKKDRQYEK 243 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 7.1 Identities = 8/31 (25%), Positives = 17/31 (54%) Frame = +1 Query: 490 RQVQRHLKWLDSNQLADKEEYEHKQKELEGI 582 R R +WL ++ + E+E ++L+G+ Sbjct: 722 RYYPRRKEWLYLHRARSESEFEMYHQQLQGV 752 >AJ547798-1|CAD67999.1| 587|Apis mellifera octopamine receptor protein. Length = 587 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/26 (30%), Positives = 16/26 (61%) Frame = +2 Query: 425 KSTMEDEKLKEKISDSDKQTILDKCN 502 + +++ EK+K +S +T+ KCN Sbjct: 331 RCSVKREKIKISVSYPSTETLNTKCN 356 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.4 bits (43), Expect = 9.4 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = -1 Query: 187 PRGAGGIPVS 158 PRG GG+P S Sbjct: 399 PRGPGGVPTS 408 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 21.4 bits (43), Expect = 9.4 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = +1 Query: 25 VTLPSPLNRLRHSPP 69 +T PSP R R++PP Sbjct: 986 MTDPSPFKRGRYTPP 1000 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,452 Number of Sequences: 438 Number of extensions: 4152 Number of successful extensions: 33 Number of sequences better than 10.0: 26 Number of HSP's better than 10.0 without gapping: 33 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 33 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23632110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -