BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30457 (770 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 24 1.4 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 22 5.5 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 22 7.3 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 21 9.6 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 21 9.6 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 21 9.6 AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 21 9.6 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 21 9.6 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +2 Query: 605 SLSTKFLAECQSRPHS 652 SL T+FL C+SR HS Sbjct: 337 SLDTQFLQVCRSRRHS 352 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 22.2 bits (45), Expect = 5.5 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -1 Query: 353 LPPYPTVPSHCWSSQTDAPCST 288 L P + + CW+ D CST Sbjct: 149 LTPTERLEALCWTQDEDVICST 170 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 21.8 bits (44), Expect = 7.3 Identities = 8/22 (36%), Positives = 11/22 (50%) Frame = -1 Query: 353 LPPYPTVPSHCWSSQTDAPCST 288 L P + + CW+ D CST Sbjct: 202 LTPTERLEALCWTQDEDIICST 223 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.6 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +3 Query: 540 FQEESLTTSVSKKLWMKWHNEHHCQPNF 623 F++E+ K W KW++ Q N+ Sbjct: 682 FKDEAKDLVSVNKSWNKWNDWQETQNNY 709 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.6 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +3 Query: 540 FQEESLTTSVSKKLWMKWHNEHHCQPNF 623 F++E+ K W KW++ Q N+ Sbjct: 682 FKDEAKDLVSVNKSWNKWNDWQETQNNY 709 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.4 bits (43), Expect = 9.6 Identities = 8/28 (28%), Positives = 14/28 (50%) Frame = +3 Query: 540 FQEESLTTSVSKKLWMKWHNEHHCQPNF 623 F++E+ K W KW++ Q N+ Sbjct: 682 FKDEAKDLVSVNKSWNKWNDWQETQNNY 709 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 21.4 bits (43), Expect = 9.6 Identities = 18/61 (29%), Positives = 24/61 (39%), Gaps = 9/61 (14%) Frame = +1 Query: 346 GGSPDENGETTLD----ALIM-----NGRTMNIGAVGGLRRIKHAISVARHVLDHTKHSF 498 GG PD+ ET D A G +G +GGL A + H + HSF Sbjct: 1681 GGGPDKIPETAEDISPYATFQLSEGGGGSLAGLGGLGGLGGAAEASAAGLHPNNTLLHSF 1740 Query: 499 L 501 + Sbjct: 1741 M 1741 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 21.4 bits (43), Expect = 9.6 Identities = 18/61 (29%), Positives = 24/61 (39%), Gaps = 9/61 (14%) Frame = +1 Query: 346 GGSPDENGETTLD----ALIM-----NGRTMNIGAVGGLRRIKHAISVARHVLDHTKHSF 498 GG PD+ ET D A G +G +GGL A + H + HSF Sbjct: 1677 GGGPDKIPETAEDISPYATFQLSEGGGGSLAGLGGLGGLGGAAEASAAGLHPNNTLLHSF 1736 Query: 499 L 501 + Sbjct: 1737 M 1737 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 224,878 Number of Sequences: 438 Number of extensions: 5022 Number of successful extensions: 10 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24154023 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -