BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30457 (770 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g61540.1 68418.m07722 L-asparaginase, putative / L-asparagine... 96 3e-20 At5g61540.2 68418.m07723 L-asparaginase, putative / L-asparagine... 48 7e-06 At3g16150.1 68416.m02039 L-asparaginase, putative / L-asparagine... 48 9e-06 At5g08100.1 68418.m00945 L-asparaginase / L-asparagine amidohydr... 44 1e-04 At4g00590.1 68417.m00083 asparaginase 2 family protein very low ... 42 3e-04 At5g08100.2 68418.m00944 L-asparaginase / L-asparagine amidohydr... 40 0.002 At4g12360.1 68417.m01954 protease inhibitor/seed storage/lipid t... 31 1.1 At5g49410.1 68418.m06114 expressed protein similar to unknown pr... 29 4.5 At2g23320.2 68415.m02784 WRKY family transcription factor identi... 29 4.5 At2g23320.1 68415.m02785 WRKY family transcription factor identi... 29 4.5 At5g15530.1 68418.m01818 biotin carboxyl carrier protein 2 (BCCP... 28 7.9 At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid t... 28 7.9 >At5g61540.1 68418.m07722 L-asparaginase, putative / L-asparagine amidohydrolase, putative similar to Swiss-Prot:O02467 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase (Glycosylasparaginase) (Aspartylglucosaminidase)(N4-(N-acetyl-beta- glucosaminyl)-L-asparagine amidase) (AGA)[Spodoptera frugiperda] Length = 359 Score = 95.9 bits (228), Expect = 3e-20 Identities = 41/78 (52%), Positives = 58/78 (74%) Frame = +1 Query: 274 TALDAVEQGASVCEDQQCDGTVGYGGSPDENGETTLDALIMNGRTMNIGAVGGLRRIKHA 453 +A++AV +G S CE+ +CDGTVG GGSPDENGET +DAL+M+G TM +GAV +R +K Sbjct: 58 SAVEAVVEGCSACEELRCDGTVGPGGSPDENGETMIDALVMDGVTMEVGAVAAMRYVKDG 117 Query: 454 ISVARHVLDHTKHSFLVG 507 I A V+ +++H+ L G Sbjct: 118 IRAAHLVMKYSQHTLLAG 135 Score = 48.0 bits (109), Expect = 7e-06 Identities = 35/99 (35%), Positives = 49/99 (49%), Gaps = 14/99 (14%) Frame = +3 Query: 513 ATQFAVEMGFQEE-SLTTSVSKKLWMKWHNEHHCQPNFWLNVSPDPTRNCGPYQKHEYSQ 689 A+ FA+ MG +L++ S K W W E+ CQPNF NV P +CGPY+ + + Sbjct: 138 ASAFAISMGLPGPMNLSSPESVKKWSDW-KENQCQPNFRKNVV--PANDCGPYKPNNSAM 194 Query: 690 HL-LKKSHLN------------VDRFNHDTIGMVAIDHM 767 ++ + KS + V NHDTI M ID M Sbjct: 195 NVFVDKSTESCEMGAIEYKPPLVGPHNHDTISMAVIDRM 233 Score = 27.9 bits (59), Expect = 7.9 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +2 Query: 146 IFLTYVLVYLTNVCSETNIPIVITTWSFTNSTVKAW 253 +FL+ + V + P+V++TW F + AW Sbjct: 15 LFLSLLTVADAELVKSDKFPVVVSTWPFLEAVRAAW 50 >At5g61540.2 68418.m07723 L-asparaginase, putative / L-asparagine amidohydrolase, putative similar to Swiss-Prot:O02467 N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase (Glycosylasparaginase) (Aspartylglucosaminidase)(N4-(N-acetyl-beta- glucosaminyl)-L-asparagine amidase) (AGA)[Spodoptera frugiperda] Length = 257 Score = 48.0 bits (109), Expect = 7e-06 Identities = 35/99 (35%), Positives = 49/99 (49%), Gaps = 14/99 (14%) Frame = +3 Query: 513 ATQFAVEMGFQEE-SLTTSVSKKLWMKWHNEHHCQPNFWLNVSPDPTRNCGPYQKHEYSQ 689 A+ FA+ MG +L++ S K W W E+ CQPNF NV P +CGPY+ + + Sbjct: 36 ASAFAISMGLPGPMNLSSPESVKKWSDW-KENQCQPNFRKNVV--PANDCGPYKPNNSAM 92 Query: 690 HL-LKKSHLN------------VDRFNHDTIGMVAIDHM 767 ++ + KS + V NHDTI M ID M Sbjct: 93 NVFVDKSTESCEMGAIEYKPPLVGPHNHDTISMAVIDRM 131 >At3g16150.1 68416.m02039 L-asparaginase, putative / L-asparagine amidohydrolase, putative similar to Swiss-Prot:P30364 L-asparaginase (EC 3.5.1.1) (L-asparagine amidohydrolase) [Lupinus angustifolius] Length = 325 Score = 47.6 bits (108), Expect = 9e-06 Identities = 27/76 (35%), Positives = 41/76 (53%) Frame = +1 Query: 274 TALDAVEQGASVCEDQQCDGTVGYGGSPDENGETTLDALIMNGRTMNIGAVGGLRRIKHA 453 +A+D VE E + G G + E G ++A IM+G GAV G+ +K+ Sbjct: 46 SAIDVVELVIRELETDPLFNS-GRGSALTEKGTVEMEASIMDGTKRRCGAVSGITTVKNP 104 Query: 454 ISVARHVLDHTKHSFL 501 IS+AR V+D + HS+L Sbjct: 105 ISLARLVMDKSPHSYL 120 >At5g08100.1 68418.m00945 L-asparaginase / L-asparagine amidohydrolase identical to Swiss-Prot:P50287 L-asparaginase (EC 3.5.1.1) (L-asparagine amidohydrolase) [Arabidopsis thaliana] Length = 315 Score = 44.0 bits (99), Expect = 1e-04 Identities = 22/58 (37%), Positives = 32/58 (55%) Frame = +1 Query: 328 DGTVGYGGSPDENGETTLDALIMNGRTMNIGAVGGLRRIKHAISVARHVLDHTKHSFL 501 D G G G ++A IM+G+T GAV GL + + IS+AR V++ T H +L Sbjct: 64 DFNAGKGSVLTAQGTVEMEASIMDGKTKRCGAVSGLTTVVNPISLARLVMEKTPHIYL 121 >At4g00590.1 68417.m00083 asparaginase 2 family protein very low similarity to glycosylasparaginase [SP|P20933] from Homo sapiens; contains Pfam profile PF01112: Asparaginase 2 Length = 408 Score = 42.3 bits (95), Expect = 3e-04 Identities = 27/83 (32%), Positives = 41/83 (49%), Gaps = 1/83 (1%) Frame = +1 Query: 280 LDAVEQGASVCEDQQCDGTVGYGGSPDENGETTLDALIMNGRTMNIGAVGGLRRIKHAIS 459 +DAV V ED G G + E+G DA +M+G + G VG + +++AI Sbjct: 55 IDAVSAAIQVLEDDPSTNA-GRGSNLTEDGHVECDASLMDGDSGMFGGVGAVPGVRNAIK 113 Query: 460 VAR-HVLDHTKHSFLVGGLPPNL 525 +A V + S L+G +PP L Sbjct: 114 IAALLVKEQITGSTLLGRIPPML 136 >At5g08100.2 68418.m00944 L-asparaginase / L-asparagine amidohydrolase identical to Swiss-Prot:P50287 L-asparaginase (EC 3.5.1.1) (L-asparagine amidohydrolase) [Arabidopsis thaliana] Length = 235 Score = 39.9 bits (89), Expect = 0.002 Identities = 18/41 (43%), Positives = 28/41 (68%) Frame = +1 Query: 379 LDALIMNGRTMNIGAVGGLRRIKHAISVARHVLDHTKHSFL 501 ++A IM+G+T GAV GL + + IS+AR V++ T H +L Sbjct: 1 MEASIMDGKTKRCGAVSGLTTVVNPISLARLVMEKTPHIYL 41 >At4g12360.1 68417.m01954 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein contains Pfam protease inhibitor/seed storage/LTP family domain PF00234 Length = 161 Score = 30.7 bits (66), Expect = 1.1 Identities = 22/80 (27%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = -1 Query: 506 PTKKECFVWSNTCLATDMACLI-LLKPPTAPIFIVLPFIIRASNVVSPFSSGLPPYPTVP 330 P +EC T L T ++CL +K P +++PF + N + + GL T P Sbjct: 58 PPSQECCTAVETALTTQLSCLCGFIKSP----MLLIPFNVTDFNALFSKTCGL---TTDP 110 Query: 329 SHCWSSQTDAPCSTASNAVP 270 + C + AP + VP Sbjct: 111 NLCSETAAQAPLPKTAAPVP 130 >At5g49410.1 68418.m06114 expressed protein similar to unknown protein (gb|AAF36742.1) Length = 145 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 429 WLEKDQTCHICC*TCIGPHKTFLFSWW 509 W+ + Q + C +GPHK FL++ W Sbjct: 90 WMRERQKLKLIC-NHVGPHKQFLYTTW 115 >At2g23320.2 68415.m02784 WRKY family transcription factor identical to WRKY DNA-binding protein 15 GI:13506742 from [Arabidopsis thaliana] Length = 262 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 422 APIFIVLPFIIRASNVVSPFSSGLPPYP 339 AP+ ++ P +++ +PF S LPP P Sbjct: 99 APVHVISPVLLQEEPKTTPFQSPLPPPP 126 >At2g23320.1 68415.m02785 WRKY family transcription factor identical to WRKY DNA-binding protein 15 GI:13506742 from [Arabidopsis thaliana] Length = 317 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/28 (35%), Positives = 17/28 (60%) Frame = -1 Query: 422 APIFIVLPFIIRASNVVSPFSSGLPPYP 339 AP+ ++ P +++ +PF S LPP P Sbjct: 99 APVHVISPVLLQEEPKTTPFQSPLPPPP 126 >At5g15530.1 68418.m01818 biotin carboxyl carrier protein 2 (BCCP2) identical to biotin carboxyl carrier protein isoform 2 [Arabidopsis thaliana] gi|8886869|gb|AAF80592 Length = 255 Score = 27.9 bits (59), Expect = 7.9 Identities = 17/55 (30%), Positives = 27/55 (49%) Frame = -1 Query: 428 PTAPIFIVLPFIIRASNVVSPFSSGLPPYPTVPSHCWSSQTDAPCSTASNAVPPL 264 P AP++ +P ++ ++ LPP PT S + T P S S++ PPL Sbjct: 130 PPAPVYHSMPPVMADFSMPPAQPVALPPSPTPTS---TPATAKPTSAPSSSHPPL 181 >At1g62500.1 68414.m07052 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein similar to auxin down regulated GB:X69640 GI:296442 from [Glycine max]; contains Pfam profile PF00234: Protease inhibitor/seed storage/LTP family Length = 297 Score = 27.9 bits (59), Expect = 7.9 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -1 Query: 440 LLKPPTAPIFIVLPFIIRASNVVSPFSSGLPPY 342 LL P T P ++ P I V P SSG PPY Sbjct: 163 LLPPVTTPPGLLPPIINPPPVTVPPPSSGYPPY 195 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,245,963 Number of Sequences: 28952 Number of extensions: 372984 Number of successful extensions: 881 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 845 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 881 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1716774400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -