BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30456 (730 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) 118 4e-27 SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) 37 0.015 SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) 37 0.019 SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) 33 0.18 SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.55 SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) 31 0.72 SB_31207| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.7 SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) 30 2.2 SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) 29 3.9 SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) 29 3.9 SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) 29 3.9 SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) 28 6.7 SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.7 SB_8252| Best HMM Match : rve (HMM E-Value=0.13) 28 6.7 SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) 28 8.9 SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 SB_23350| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.9 >SB_19071| Best HMM Match : Ribosomal_L4 (HMM E-Value=0) Length = 299 Score = 118 bits (285), Expect = 4e-27 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +2 Query: 254 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRRWH 409 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTK WR+WH Sbjct: 58 QTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRKWH 109 Score = 89.8 bits (213), Expect = 2e-18 Identities = 39/72 (54%), Positives = 54/72 (75%) Frame = +3 Query: 507 KIPELPLVVADKVQEINKTKQAVIFLRRLKAWSDILKVYKSQRLRAGKGKMRNRRRIQRK 686 KI E+PLV++D ++ + KT AV L+ + A+ D+ K S+++RAGKGKMRNRR + RK Sbjct: 143 KIAEVPLVISDAIESVTKTSAAVKLLKAVNAYEDVEKCIDSKKIRAGKGKMRNRRTVMRK 202 Query: 687 GPLIIFNKDQGL 722 GPLII+N DQGL Sbjct: 203 GPLIIYNNDQGL 214 Score = 70.9 bits (166), Expect = 1e-12 Identities = 33/59 (55%), Positives = 44/59 (74%) Frame = +3 Query: 81 ARPLVSVYSEKSETVQGAAKPLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHK 257 ARP+++V++E E+ LP VFKAPIRPDLVN VH +++KN RQPY V+K AGH+ Sbjct: 2 ARPVITVFNENGESA--GQTTLPAVFKAPIRPDLVNFVHSNIAKNKRQPYAVNKLAGHQ 58 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = +1 Query: 451 SVAATGVPALVQARGHIIERFPSFP 525 ++AA+ +PAL+ ARGH IE+ P Sbjct: 124 ALAASALPALIMARGHRIEKIAEVP 148 >SB_29069| Best HMM Match : Furin-like (HMM E-Value=0.042) Length = 628 Score = 37.1 bits (82), Expect = 0.015 Identities = 20/54 (37%), Positives = 23/54 (42%) Frame = +2 Query: 242 GGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 403 GGW Q WG G+ + R GGG R G +G M GG P W R Sbjct: 14 GGWGQGPGGGWGRGQG-GGMGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 66 Score = 27.9 bits (59), Expect = 8.9 Identities = 18/54 (33%), Positives = 22/54 (40%), Gaps = 2/54 (3%) Frame = +2 Query: 242 GGWSQTSAESWGT--GRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPW 397 GG + WG G + R P GGG R G +G M GG P + W Sbjct: 54 GGMGRGPGGGWGRMQGGGMGRGP---GGGLGRGPGGGWGRMQEGGMGRGPGQGW 104 >SB_53717| Best HMM Match : Furin-like (HMM E-Value=0.05) Length = 1098 Score = 36.7 bits (81), Expect = 0.019 Identities = 20/54 (37%), Positives = 23/54 (42%) Frame = +2 Query: 242 GGWSQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKPWRR 403 GGW Q WG G+ + R GGG R G +G M GG P W R Sbjct: 258 GGWGQGPGGGWGRGQGRG-MGRGPGGGWGRGSGGGWGRMQGGGMGRGPGGGWGR 310 >SB_3575| Best HMM Match : DUF943 (HMM E-Value=4.5) Length = 612 Score = 33.5 bits (73), Expect = 0.18 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -3 Query: 368 HHDTCYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWF 255 HH CY H Y Y+ H H + R H YP +H++ Sbjct: 20 HHYCCYCHH---RYCYYRHHHYCWYRHHYHYPCYRHYY 54 >SB_35460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 511 Score = 31.9 bits (69), Expect = 0.55 Identities = 12/31 (38%), Positives = 16/31 (51%) Frame = -3 Query: 353 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQH 261 Y +HP T+ YH H R H Q+P + H Sbjct: 232 YHQHPQVTHRYHQHPQVTH-RYHQQHPQVTH 261 Score = 31.5 bits (68), Expect = 0.72 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -3 Query: 353 YRRHPDRTYEYHHHGHAEFGRQHVQYPMIQH 261 Y +HP T+ YHH H + ++ Q+P + H Sbjct: 413 YHQHPQLTHRYHHQ-HPQVIHRYHQHPQVTH 442 >SB_11562| Best HMM Match : SelP_N (HMM E-Value=0.45) Length = 453 Score = 31.5 bits (68), Expect = 0.72 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = -3 Query: 368 HHDTCYRRHPDRTYEYHHHGHAEFGRQH 285 HH RH R + +HHH H E+ R+H Sbjct: 325 HHQRHRHRHRHR-HRHHHHHHHEYNRRH 351 >SB_31207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 30.3 bits (65), Expect = 1.7 Identities = 17/50 (34%), Positives = 24/50 (48%) Frame = -3 Query: 674 TTTVAHFTLTSTKTLRLVHLKDIRPCLEAPQEDDSLFGLVDLLDFVGYNQ 525 +T + HF KT R +H+K P E GL+D+LD G+ Q Sbjct: 18 STVLHHFIDKHAKTPRFLHMKP-----NGPGEGGGSSGLLDMLDAAGFEQ 62 >SB_16091| Best HMM Match : 7tm_1 (HMM E-Value=9.5e-08) Length = 839 Score = 29.9 bits (64), Expect = 2.2 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -3 Query: 368 HHDTCYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWFVTSLL 240 HH + RH R + YHHH + H +P FVT+++ Sbjct: 570 HHHLHHHRHHHRHHHYHHHHYP----HHHHHPCTIIIFVTTII 608 >SB_49912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 29.5 bits (63), Expect = 2.9 Identities = 12/25 (48%), Positives = 13/25 (52%) Frame = -3 Query: 377 TYVHHDTCYRRHPDRTYEYHHHGHA 303 TY H DT R+HPD H HA Sbjct: 123 TYTHQDTQMRKHPDTQIYVHAPRHA 147 >SB_13394| Best HMM Match : Chordopox_A13L (HMM E-Value=3.2) Length = 694 Score = 29.1 bits (62), Expect = 3.9 Identities = 9/35 (25%), Positives = 14/35 (40%) Frame = -3 Query: 380 RTYVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQY 276 R + HH + H + +HHH H H + Sbjct: 209 RHHQHHQHHHHHHHQHNHHHHHHNHHHHHHHHYHH 243 >SB_54269| Best HMM Match : M (HMM E-Value=8.1e-20) Length = 3489 Score = 29.1 bits (62), Expect = 3.9 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 5/47 (10%) Frame = +2 Query: 209 QELEAALLREQGGWSQTSAESWGTGRA----VARIPR-VRGGGTHRS 334 + E+AL E+ W+Q AES T RA +AR+ R GT RS Sbjct: 3432 EHAESALAAERAQWAQEKAESQNTIRAANEEIARLKEDARKAGTERS 3478 >SB_37045| Best HMM Match : Drf_FH1 (HMM E-Value=0.95) Length = 1080 Score = 29.1 bits (62), Expect = 3.9 Identities = 17/40 (42%), Positives = 21/40 (52%), Gaps = 1/40 (2%) Frame = +2 Query: 257 TSAESWGTGRAVARIPR-VRGGGTHRSGQGAFGNMCRGGR 373 T +E +G ++ R PR RGGG G G G RGGR Sbjct: 983 TPSEPSSSGSSIVRRPRRRRGGGGGGGGGGGGGGGRRGGR 1022 >SB_20534| Best HMM Match : DUF21 (HMM E-Value=9.8) Length = 193 Score = 28.3 bits (60), Expect = 6.7 Identities = 9/19 (47%), Positives = 11/19 (57%) Frame = -3 Query: 368 HHDTCYRRHPDRTYEYHHH 312 HH YR H + Y +HHH Sbjct: 96 HHHQHYRHHRHQHYRHHHH 114 >SB_19884| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3486 Score = 28.3 bits (60), Expect = 6.7 Identities = 12/28 (42%), Positives = 18/28 (64%) Frame = -1 Query: 148 GRGLAAPCTVSLFSEYTDTKGRATDRLI 65 G+GL C+V+L S Y T+G+ RL+ Sbjct: 3163 GKGLTTWCSVNLDSVYLSTEGKEVYRLV 3190 >SB_8252| Best HMM Match : rve (HMM E-Value=0.13) Length = 264 Score = 28.3 bits (60), Expect = 6.7 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 374 YVHHDTCYRRHPDRTYEYHHHGH 306 Y HH +RR R + +HHH H Sbjct: 233 YHHHHHHHRRRRRRRHHHHHHHH 255 >SB_9657| Best HMM Match : P_proprotein (HMM E-Value=7.5e-29) Length = 1779 Score = 27.9 bits (59), Expect = 8.9 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = -3 Query: 368 HHDTCYRRHPDRTYEYHHHGH 306 HH + RH DR + + HH H Sbjct: 340 HHRNKHYRHHDRNHHHRHHHH 360 >SB_44956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 736 Score = 27.9 bits (59), Expect = 8.9 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = -3 Query: 356 CYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQH 261 CY + + + YHHH H H Q+ H Sbjct: 246 CYHKLKNPRHRYHHHHHHHHQHNHHQHHHHHH 277 Score = 27.9 bits (59), Expect = 8.9 Identities = 10/47 (21%), Positives = 22/47 (46%) Frame = -3 Query: 380 RTYVHHDTCYRRHPDRTYEYHHHGHAEFGRQHVQYPMIQHWFVTSLL 240 R + HH ++ + + + +HHH H H Q+ H + +++ Sbjct: 256 RYHHHHHHHHQHNHHQHHHHHHHHHHNHHHHHQQHHHHHHHHIINII 302 >SB_23350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 704 Score = 27.9 bits (59), Expect = 8.9 Identities = 12/31 (38%), Positives = 20/31 (64%) Frame = -3 Query: 722 QTLILVEDYEGSLTLDTTTVAHFTLTSTKTL 630 Q LIL+ Y + L+T+++ F+L S KT+ Sbjct: 235 QELILIPYYTEKVALETSSLIEFSLLSAKTI 265 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,018,741 Number of Sequences: 59808 Number of extensions: 464565 Number of successful extensions: 1646 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1248 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1570 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -