BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30454 (328 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15) 28 1.6 SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) 28 1.6 SB_24457| Best HMM Match : TPR_2 (HMM E-Value=1.4e-16) 28 2.1 SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) 28 2.1 SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 4.8 SB_19573| Best HMM Match : No HMM Matches (HMM E-Value=.) 26 8.3 >SB_43934| Best HMM Match : Band_41 (HMM E-Value=1.2e-15) Length = 378 Score = 28.3 bits (60), Expect = 1.6 Identities = 15/39 (38%), Positives = 21/39 (53%) Frame = +3 Query: 30 WHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRKFNG 146 + W VDSI+ S+A+F S + H T LR F+G Sbjct: 265 YEWPLVDSITASKAKFYFSCATNENHKEQGTVCLR-FHG 302 >SB_27773| Best HMM Match : Mito_carr (HMM E-Value=0) Length = 203 Score = 28.3 bits (60), Expect = 1.6 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = +3 Query: 18 CCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRK 137 C ++H G+++ I + R Q+ G+ R C TS+ ++ Sbjct: 6 CATVFHDGAMNPIEVIKQRLQMYGSPYRGVIHCATSVFKE 45 >SB_24457| Best HMM Match : TPR_2 (HMM E-Value=1.4e-16) Length = 1134 Score = 27.9 bits (59), Expect = 2.1 Identities = 11/40 (27%), Positives = 20/40 (50%) Frame = -1 Query: 271 LIPNKTKRSDPGAMSRTGDV*HHLMAWGLPWQQQSTVTQC 152 + P+ T +S P + D +++ W WQ + VT+C Sbjct: 961 MTPSYTAQSHPWMTTALQDDLDNVLDWSAAWQMEFNVTKC 1000 >SB_15233| Best HMM Match : fn3 (HMM E-Value=1.1e-15) Length = 594 Score = 27.9 bits (59), Expect = 2.1 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +3 Query: 30 WHWGSVDSISGSRARFQLSGNSGRKHSR 113 WH S +S++G R R+ +S S H+R Sbjct: 20 WHCYSEESLTGDRRRYNISKQSTLYHTR 47 >SB_45157| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2870 Score = 26.6 bits (56), Expect = 4.8 Identities = 14/53 (26%), Positives = 25/53 (47%) Frame = +3 Query: 15 RCCNIWHWGSVDSISGSRARFQLSGNSGRKHSRCCTSILRKFNGRQHCVTVDC 173 +CC + G S + + SG + +RCC ++L+ N +H T +C Sbjct: 1386 QCCLLADNGQHSSTASCPSACSPSGCNPDCPARCCITVLQPLN-EKHNTTAEC 1437 >SB_19573| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 554 Score = 25.8 bits (54), Expect = 8.3 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +3 Query: 21 CNIWHWGSVDSISGSRARF 77 C + HWGSV + + RAR+ Sbjct: 35 CQVPHWGSVRTFNVCRARY 53 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,727,262 Number of Sequences: 59808 Number of extensions: 201988 Number of successful extensions: 468 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 16,821,457 effective HSP length: 72 effective length of database: 12,515,281 effective search space used: 450550116 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -