BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30454 (328 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase p... 24 1.7 AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. 23 2.9 AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. 23 3.9 AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. 22 5.1 AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. 22 6.8 AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding pr... 21 8.9 >AJ010193-1|CAA09032.1| 684|Anopheles gambiae prophenoloxidase protein. Length = 684 Score = 23.8 bits (49), Expect = 1.7 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 59 TNGVNRPPVPYITAPPTAF 3 TN R P+P ITAP A+ Sbjct: 54 TNAQTRIPLPNITAPDLAY 72 >AY753541-1|AAV28544.1| 3398|Anopheles gambiae SGS4 protein. Length = 3398 Score = 23.0 bits (47), Expect = 2.9 Identities = 8/12 (66%), Positives = 10/12 (83%) Frame = -3 Query: 71 STGATNGVNRPP 36 STG++N NRPP Sbjct: 1627 STGSSNSCNRPP 1638 >AY578801-1|AAT07306.1| 506|Anopheles gambiae dSmad2 protein. Length = 506 Score = 22.6 bits (46), Expect = 3.9 Identities = 5/12 (41%), Positives = 8/12 (66%) Frame = +3 Query: 18 CCNIWHWGSVDS 53 CC +W W ++S Sbjct: 88 CCRLWRWPDLNS 99 >AJ302661-1|CAC35526.1| 128|Anopheles gambiae gSG8 protein protein. Length = 128 Score = 22.2 bits (45), Expect = 5.1 Identities = 13/45 (28%), Positives = 19/45 (42%), Gaps = 2/45 (4%) Frame = -1 Query: 274 ILIPNKTKRSDPGAMSRTGDV*HHLMAWGLPWQQQSTVT--QCCR 146 +L+ T R DP RT L+ W + + VT +C R Sbjct: 15 LLLSLATLRGDPFVALRTSTTNRTLLCWAIKLSPTAYVTDAECVR 59 >AY645021-1|AAT92557.1| 163|Anopheles gambiae even-skipped protein. Length = 163 Score = 21.8 bits (44), Expect = 6.8 Identities = 12/39 (30%), Positives = 20/39 (51%) Frame = -1 Query: 130 SMLVQQRLCFLPLFPLS*NRAREPLMESTDPQCHILQHR 14 SMLV + P PLS ++++ P ++ H L H+ Sbjct: 38 SMLVTGSMPPSPYAPLSMSKSQTPPQDTVGTAQHQLHHQ 76 >AY146759-1|AAO12074.1| 356|Anopheles gambiae odorant-binding protein AgamOBP45 protein. Length = 356 Score = 21.4 bits (43), Expect = 8.9 Identities = 6/9 (66%), Positives = 6/9 (66%) Frame = +3 Query: 153 HCVTVDCCC 179 H T DCCC Sbjct: 125 HADTTDCCC 133 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 360,575 Number of Sequences: 2352 Number of extensions: 7366 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 56 effective length of database: 432,267 effective search space used: 22477884 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -