BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30447 (689 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hor... 24 1.0 DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hor... 24 1.0 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 24 1.0 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 24 1.0 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 24 1.0 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 24 1.0 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 24 1.0 AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax pr... 24 1.0 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 24 1.0 L01616-1|AAA30096.1| 74|Tribolium castaneum zinc finger protei... 22 5.4 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 22 5.4 AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein ... 22 5.4 >EF222290-1|ABN79650.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 24.2 bits (50), Expect = 1.0 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +3 Query: 195 RRKKQIILLVWKRINDTRCRRKFWFHITSRGQ*LWYKRCL 314 RR K ++L W + FH+ S WY++C+ Sbjct: 166 RRDKFMLLGAWLGATLCSIPQMVVFHVESHPNITWYQQCV 205 >DQ422965-1|ABE02225.1| 378|Tribolium castaneum adipokinetic hormone receptor protein. Length = 378 Score = 24.2 bits (50), Expect = 1.0 Identities = 11/40 (27%), Positives = 18/40 (45%) Frame = +3 Query: 195 RRKKQIILLVWKRINDTRCRRKFWFHITSRGQ*LWYKRCL 314 RR K ++L W + FH+ S WY++C+ Sbjct: 166 RRDKFMLLGAWLGATLCSIPQMVVFHVESHPNITWYQQCV 205 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 221 RLETDKRYKMPSQVLVPYH 277 R++ K +KM S +VPYH Sbjct: 272 RMKWKKEHKMASMNIVPYH 290 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 221 RLETDKRYKMPSQVLVPYH 277 R++ K +KM S +VPYH Sbjct: 272 RMKWKKEHKMASMNIVPYH 290 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 221 RLETDKRYKMPSQVLVPYH 277 R++ K +KM S +VPYH Sbjct: 272 RMKWKKEHKMASMNIVPYH 290 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 221 RLETDKRYKMPSQVLVPYH 277 R++ K +KM S +VPYH Sbjct: 228 RMKWKKEHKMASMNIVPYH 246 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 221 RLETDKRYKMPSQVLVPYH 277 R++ K +KM S +VPYH Sbjct: 272 RMKWKKEHKMASMNIVPYH 290 >AF264695-1|AAG13009.1| 100|Tribolium castaneum cephalothorax protein. Length = 100 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 221 RLETDKRYKMPSQVLVPYH 277 R++ K +KM S +VPYH Sbjct: 60 RMKWKKEHKMASMNIVPYH 78 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 24.2 bits (50), Expect = 1.0 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 221 RLETDKRYKMPSQVLVPYH 277 R++ K +KM S +VPYH Sbjct: 272 RMKWKKEHKMASMNIVPYH 290 >L01616-1|AAA30096.1| 74|Tribolium castaneum zinc finger protein protein. Length = 74 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 292 HCPLEVIWNQNLRRHL 245 HC + + NLRRHL Sbjct: 42 HCDRQFVQVANLRRHL 57 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/28 (28%), Positives = 17/28 (60%) Frame = +1 Query: 13 NKISEKQPIILSCDSIFPRNVFKLIPQQ 96 +K+ + + ++ D + PR V +IP+Q Sbjct: 163 HKLKKMKYLVEVQDEVKPRGVLNIIPKQ 190 >AF236856-1|AAG17563.2| 370|Tribolium castaneum Kruppel protein protein. Length = 370 Score = 21.8 bits (44), Expect = 5.4 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = -2 Query: 292 HCPLEVIWNQNLRRHL 245 HC + + NLRRHL Sbjct: 195 HCDRQFVQVANLRRHL 210 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,850 Number of Sequences: 336 Number of extensions: 3841 Number of successful extensions: 13 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18114270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -