BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30447 (689 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein... 25 2.3 AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. 25 3.0 AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced ... 24 3.9 AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 23 6.9 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 23 9.1 >AJ439353-6|CAD27928.1| 695|Anopheles gambiae putative G-protein coupled receptor protein. Length = 695 Score = 25.0 bits (52), Expect = 2.3 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +3 Query: 477 PFENNTVRLDLMDENGKTPPGYTTWQFNFKFNLQEDMYAQDSID 608 P E N +++ K+P +TT + NL DM D ID Sbjct: 125 PGEENVIKVYSSKSLRKSPQAHTTDDESSFDNLNNDMKGHDFID 168 >AJ535204-1|CAD59404.1| 1187|Anopheles gambiae SMC2 protein protein. Length = 1187 Score = 24.6 bits (51), Expect = 3.0 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 301 IKDVWNHNLHEEFQIIRQVVQKYHWVAMDTEFPGV 405 I V N N + + I + QKY W+ D EF GV Sbjct: 915 ITKVRNEN-KDGYDRISGMEQKYPWIPEDKEFFGV 948 >AF080564-1|AAC31944.1| 372|Anopheles gambiae Sex combs reduced homeotic protein protein. Length = 372 Score = 24.2 bits (50), Expect = 3.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = +2 Query: 221 RLETDKRYKMPSQVLVPYH 277 R++ K +KM S +VPYH Sbjct: 332 RMKWKKEHKMASMNIVPYH 350 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 23.4 bits (48), Expect = 6.9 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +1 Query: 307 DVWNHNLHEEFQIIRQVVQKYHWVAMDTEFP 399 D + H L+E+ Q++ +Y ++MDT P Sbjct: 8 DSYRHELYEQQQLLGTSPIQYTVLSMDTPSP 38 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = +3 Query: 348 QTGSPKVSLGSYGYRISRSSCTTNWRI 428 Q SP++S YG+R RS+ + R+ Sbjct: 592 QQDSPQLSDAQYGFRRGRSTISAIQRV 618 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 743,635 Number of Sequences: 2352 Number of extensions: 15238 Number of successful extensions: 38 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 36 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 69831885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -