BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30443 (547 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_54575| Best HMM Match : S10_plectin (HMM E-Value=0) 138 4e-33 SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) 30 1.1 SB_37766| Best HMM Match : IncA (HMM E-Value=0.4) 29 1.9 SB_53804| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.3 SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_3936| Best HMM Match : Collagen (HMM E-Value=7.5e-24) 28 5.7 SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) 27 7.6 SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 7.6 >SB_54575| Best HMM Match : S10_plectin (HMM E-Value=0) Length = 166 Score = 138 bits (333), Expect = 4e-33 Identities = 58/78 (74%), Positives = 71/78 (91%) Frame = +1 Query: 19 MLMPKQNRVAIYEYLFKEGVMVAKKDYHAPKHTELEKIPNLQVIKAMQSLKSRGYVKEQF 198 ML+PK+NRV IYEYLFKEGV VAKKD+++PKHT++E +PNL VIKA+QSLKSRGYV+E+F Sbjct: 1 MLIPKKNRVIIYEYLFKEGVCVAKKDFNSPKHTQIENVPNLHVIKALQSLKSRGYVEEKF 60 Query: 199 AWRHFYWYLTNEGIEYLR 252 W+H+YW LTNEGI YLR Sbjct: 61 CWKHYYWNLTNEGITYLR 78 Score = 61.7 bits (143), Expect = 4e-10 Identities = 41/84 (48%), Positives = 48/84 (57%), Gaps = 4/84 (4%) Frame = +3 Query: 246 LENFLHLPPEIVPATLKRSV-RTETVRRGPVGR--PDAPARSAE-DRSAYRRTPAAPGVA 413 L +FLHLP EIVPATL+R V R ET R P G P P + DR +YRR P PGV Sbjct: 77 LRDFLHLPTEIVPATLRRQVTRAETARPRPKGMDGPRGPGEGGDRDRESYRRGP-PPGV- 134 Query: 414 PHDKKADVGPGSADLEFKGGYGRG 485 + K G G EF+ G+GRG Sbjct: 135 --EGKGGAGSGFKP-EFRQGFGRG 155 >SB_33564| Best HMM Match : RVT_1 (HMM E-Value=0.1) Length = 2075 Score = 30.3 bits (65), Expect = 1.1 Identities = 13/22 (59%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = +3 Query: 387 RTPAAPGVAPHDK-KADVGPGS 449 +TPA PG+AP D K VGPG+ Sbjct: 365 KTPALPGIAPSDALKGTVGPGN 386 >SB_37766| Best HMM Match : IncA (HMM E-Value=0.4) Length = 585 Score = 29.5 bits (63), Expect = 1.9 Identities = 11/16 (68%), Positives = 13/16 (81%) Frame = +3 Query: 396 AAPGVAPHDKKADVGP 443 A PG+APHDKK+ GP Sbjct: 545 ARPGLAPHDKKSGKGP 560 >SB_53804| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 522 Score = 28.3 bits (60), Expect = 4.3 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = +1 Query: 217 WYLTNEGIEYLRISCTFLLKLCLQHLSAQYVQRQYAVALLVV 342 WY + EY R+ +L + CL+++ + + R++ V + V Sbjct: 463 WYSSPYPEEYQRLKKIYLCEFCLKYMKSPTILRRHMVVTVTV 504 >SB_46720| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1705 Score = 27.9 bits (59), Expect = 5.7 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +3 Query: 324 RGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGP 443 +GP+G P P + R P PG P K+ + GP Sbjct: 199 QGPIGPPGRPGPKGPKDTCPRCPPGPPG--PKGKRGETGP 236 >SB_40971| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 828 Score = 27.9 bits (59), Expect = 5.7 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 4/53 (7%) Frame = +3 Query: 261 HLPPEIVPATLKRSVRTETVRRGPVGRPDAP----ARSAEDRSAYRRTPAAPG 407 HL P ++ + S+ RGP GRP P R + R P +PG Sbjct: 110 HLSPAVIRLCMGGSLTCPPGPRGPPGRPGHPGQKGTRGRRGQRGRRGNPGSPG 162 >SB_3936| Best HMM Match : Collagen (HMM E-Value=7.5e-24) Length = 270 Score = 27.9 bits (59), Expect = 5.7 Identities = 13/40 (32%), Positives = 18/40 (45%) Frame = +3 Query: 324 RGPVGRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGP 443 +GP+G P P + R P PG P K+ + GP Sbjct: 199 QGPIGPPGRPGPKGPKDTCPRCPPGPPG--PKGKRGETGP 236 >SB_54883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2070 Score = 27.5 bits (58), Expect = 7.6 Identities = 10/32 (31%), Positives = 18/32 (56%) Frame = +1 Query: 43 VAIYEYLFKEGVMVAKKDYHAPKHTELEKIPN 138 +A +++L K + + APK +EK+PN Sbjct: 1395 IADFDFLSKSAIQALRLPVPAPKVNNMEKVPN 1426 >SB_45482| Best HMM Match : BTB (HMM E-Value=5.6e-11) Length = 3037 Score = 27.5 bits (58), Expect = 7.6 Identities = 21/69 (30%), Positives = 34/69 (49%) Frame = +1 Query: 115 TELEKIPNLQVIKAMQSLKSRGYVKEQFAWRHFYWYLTNEGIEYLRISCTFLLKLCLQHL 294 T LE+ + M + KS G K++ R YL +EG Y R T LLK+ + Sbjct: 2066 TALERFHKDVNVAMMITGKSTGGDKKEMDMRP---YLYDEGDSYERPFYTTLLKMLYEVA 2122 Query: 295 SAQYVQRQY 321 ++ + ++QY Sbjct: 2123 TSTFYEKQY 2131 >SB_13311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 6406 Score = 27.5 bits (58), Expect = 7.6 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = +3 Query: 336 GRPDAPARSAEDRSAYRRTPAAPGVAPHDKKADVGPGS 449 G P+ + S+E R RT AP P K PG+ Sbjct: 6325 GEPEGTSPSSESRIPVGRTTKAPTTKPASKTTTTRPGT 6362 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,330,840 Number of Sequences: 59808 Number of extensions: 297958 Number of successful extensions: 1052 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1052 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -