BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30435 (665 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A2FJC7 Cluster: Ankyrin repeat protein, putative; n=1; ... 34 3.5 UniRef50_UPI0000549DB6 Cluster: PREDICTED: similar to serine-thr... 33 8.2 >UniRef50_A2FJC7 Cluster: Ankyrin repeat protein, putative; n=1; Trichomonas vaginalis G3|Rep: Ankyrin repeat protein, putative - Trichomonas vaginalis G3 Length = 598 Score = 33.9 bits (74), Expect = 3.5 Identities = 17/52 (32%), Positives = 30/52 (57%) Frame = +1 Query: 85 IDISEFLCSHTYNIGSASMASYSLCHKHVTNDWKRNSDFFLIIGNRTINVND 240 ++++EFL SH ++ + ++ +L H TN++K N FLI+ IN D Sbjct: 445 VELAEFLISHHLDVNAKNINGKTLLHFAATNNYK-NMIEFLILHGANINEKD 495 >UniRef50_UPI0000549DB6 Cluster: PREDICTED: similar to serine-threonine specific protein phosphatase; n=3; Danio rerio|Rep: PREDICTED: similar to serine-threonine specific protein phosphatase - Danio rerio Length = 297 Score = 32.7 bits (71), Expect = 8.2 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = -2 Query: 409 RLFLDQIFCSRLGVIEQAPMLSMCLCLNVIKKAKEKDVKRS 287 R+ L+Q+FCS LG+ A +L++C VI + D + S Sbjct: 174 RVCLEQVFCSELGITGTAQVLNLCFQKEVIVRYSFTDWRSS 214 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 551,601,829 Number of Sequences: 1657284 Number of extensions: 9583463 Number of successful extensions: 17389 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17033 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17388 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 50826451017 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -