BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30435 (665 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ133103-1|CAB63452.1| 897|Drosophila melanogaster RFX transcri... 29 4.3 AE014297-1144|AAF54526.2| 897|Drosophila melanogaster CG6312-PA... 29 4.3 >AJ133103-1|CAB63452.1| 897|Drosophila melanogaster RFX transcription factor protein. Length = 897 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 158 HKEYEAIDADPILYVCEQRNSDMSIHMTCQY 66 HK EA D I +CE+ DM CQ+ Sbjct: 835 HKIAEAQDKTAIAVICERMKKDMDFEFECQF 865 >AE014297-1144|AAF54526.2| 897|Drosophila melanogaster CG6312-PA protein. Length = 897 Score = 29.5 bits (63), Expect = 4.3 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = -1 Query: 158 HKEYEAIDADPILYVCEQRNSDMSIHMTCQY 66 HK EA D I +CE+ DM CQ+ Sbjct: 835 HKIAEAQDKTAIAVICERMKKDMDFEFECQF 865 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,667,536 Number of Sequences: 53049 Number of extensions: 441023 Number of successful extensions: 725 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 725 length of database: 24,988,368 effective HSP length: 82 effective length of database: 20,638,350 effective search space used: 2868730650 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -