BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30432X (304 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. 31 0.013 AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 26 0.27 AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CY... 23 2.5 AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinestera... 22 4.4 AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinestera... 22 4.4 AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinestera... 22 4.4 AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-tran... 22 4.4 AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcript... 22 4.4 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 21 7.8 >AY353563-1|AAQ57599.1| 1132|Anopheles gambiae relish protein. Length = 1132 Score = 30.7 bits (66), Expect = 0.013 Identities = 21/77 (27%), Positives = 36/77 (46%), Gaps = 6/77 (7%) Frame = +2 Query: 14 ILEKNPSAAEQVDKKGRNFLHVAIQTCDMESVMFLLSVEVDVNSRVQDATLAPPLHLA-- 187 +LE S E+ K G N LH+A+ ++ V ++L + R ++ PL LA Sbjct: 870 LLEAGASVREKDLKHGNNILHIAVDNDALDIVHYILEEVKEELGRERNNAGYTPLQLADA 929 Query: 188 ----ASAGNEVLLRSLL 226 N++++R LL Sbjct: 930 KSHTGQGNNKLIVRELL 946 Score = 25.8 bits (54), Expect = 0.36 Identities = 11/22 (50%), Positives = 17/22 (77%) Frame = +2 Query: 176 LHLAASAGNEVLLRSLLLAGAR 241 LHLA S +E ++++LL AGA+ Sbjct: 788 LHLAVSCNSEPIVKALLGAGAK 809 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 26.2 bits (55), Expect = 0.27 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -1 Query: 145 RVHVHLHGEQEHHAFHVARL 86 RVH+ H HH H+AR+ Sbjct: 84 RVHIFEHAANHHHLAHLARV 103 >AY313948-1|AAP76391.1| 424|Anopheles gambiae cytochrome P450 CYP6M4 protein. Length = 424 Score = 23.0 bits (47), Expect = 2.5 Identities = 9/20 (45%), Positives = 15/20 (75%) Frame = -2 Query: 246 FGRAPANSRLLSRTSFPALA 187 FGR+ +N +LL +FP++A Sbjct: 153 FGRSRSNLQLLLMNAFPSVA 172 >AJ515150-1|CAD56157.2| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +2 Query: 176 LHLAASAGNEVLLRSLLLAGARPNDRARINARLCTLRQXR 295 LHL ++ ++ R++L +G+ A ++ TLR R Sbjct: 368 LHLLSALSRDLFQRAILQSGSPTAPWALVSREEATLRALR 407 >AJ515149-1|CAD56156.1| 737|Anopheles gambiae acetylcholinesterase protein. Length = 737 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +2 Query: 176 LHLAASAGNEVLLRSLLLAGARPNDRARINARLCTLRQXR 295 LHL ++ ++ R++L +G+ A ++ TLR R Sbjct: 368 LHLLSALSRDLFQRAILQSGSPTAPWALVSREEATLRALR 407 >AJ488492-1|CAD32684.2| 623|Anopheles gambiae acetylcholinesterase protein. Length = 623 Score = 22.2 bits (45), Expect = 4.4 Identities = 11/40 (27%), Positives = 21/40 (52%) Frame = +2 Query: 176 LHLAASAGNEVLLRSLLLAGARPNDRARINARLCTLRQXR 295 LHL ++ ++ R++L +G+ A ++ TLR R Sbjct: 254 LHLLSALSRDLFQRAILQSGSPTAPWALVSREEATLRALR 293 >AF515521-1|AAM61888.1| 233|Anopheles gambiae glutathione S-transferase u1 protein. Length = 233 Score = 22.2 bits (45), Expect = 4.4 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = +2 Query: 242 PNDRARINARLC 277 P DRA +N RLC Sbjct: 87 PKDRALVNHRLC 98 >AB090816-2|BAC57908.1| 1201|Anopheles gambiae reverse transcriptase protein. Length = 1201 Score = 22.2 bits (45), Expect = 4.4 Identities = 12/36 (33%), Positives = 16/36 (44%) Frame = -1 Query: 235 AS*QQAPEQDLVPRAGGEVXXXXXRGVLHARVHVHL 128 +S +Q PE+ + G V L RVH HL Sbjct: 782 SSLKQPPEEVFITFGGVNVPFSRSIKYLGVRVHAHL 817 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 21.4 bits (43), Expect = 7.8 Identities = 12/28 (42%), Positives = 14/28 (50%) Frame = +2 Query: 125 VEVDVNSRVQDATLAPPLHLAASAGNEV 208 VEV + VQ L+ P HL A N V Sbjct: 622 VEVVLVDEVQQPNLSHPFHLHGYAYNVV 649 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 266,923 Number of Sequences: 2352 Number of extensions: 3731 Number of successful extensions: 13 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 563,979 effective HSP length: 55 effective length of database: 434,619 effective search space used: 19557855 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -