BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30431 (792 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_04_0225 - 21063445-21063636,21063726-21063911,21064052-210641... 28 7.4 03_04_0010 + 16364037-16364046,16364769-16364858,16366018-163661... 28 9.8 >02_04_0225 - 21063445-21063636,21063726-21063911,21064052-21064138, 21064589-21064648,21064984-21065052,21065684-21065837, 21066127-21066203,21066634-21066679,21067167-21067253, 21067653-21067799,21069042-21069304 Length = 455 Score = 28.3 bits (60), Expect = 7.4 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +2 Query: 212 DLKTYISRWVAHLRLNVYGLQ*PLNTKWAVSSST*PPNHLSN 337 DL+ IS W+ L YG Q LN+ + ++S T PP++ N Sbjct: 199 DLQPDISHWIVRSYLLHYGYQDTLNS-FDMASETDPPSNHQN 239 >03_04_0010 + 16364037-16364046,16364769-16364858,16366018-16366151, 16367092-16367250,16368191-16368292 Length = 164 Score = 27.9 bits (59), Expect = 9.8 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +3 Query: 186 WGSRCNCTEILKLISQGGW 242 W + C C +I +L++ GGW Sbjct: 128 WRTMCGCKDIKELLAVGGW 146 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,104,869 Number of Sequences: 37544 Number of extensions: 359677 Number of successful extensions: 677 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 664 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 677 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2138915688 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -