BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30429 (525 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 49 3e-08 DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor pr... 21 7.7 AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 21 7.7 AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor ... 21 7.7 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 49.2 bits (112), Expect = 3e-08 Identities = 27/68 (39%), Positives = 43/68 (63%), Gaps = 2/68 (2%) Frame = +3 Query: 234 NIVEGTNCAGGEAGKDSCKGDSGGPLMYEH--SKKYEAVGIVSFGPEKCGQIDIPGVYTN 407 NI+ CA + GKD+C+ DSGGP+++++ +K+ +GI+S+G E CG+ P T Sbjct: 329 NIMVNAMCAYAK-GKDACQMDSGGPVLWQNPRTKRLVNIGIISWGAE-CGK--YPNGNTK 384 Query: 408 VYEYLPWI 431 V Y+ WI Sbjct: 385 VGSYIDWI 392 >DQ869053-1|ABJ09600.1| 459|Apis mellifera capa-like receptor protein. Length = 459 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/16 (43%), Positives = 9/16 (56%) Frame = -2 Query: 431 YPWQVFINICVNSRYI 384 YPWQ + IC Y+ Sbjct: 98 YPWQWGLGICKLRAYV 113 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 21.0 bits (42), Expect = 7.7 Identities = 8/17 (47%), Positives = 9/17 (52%) Frame = -3 Query: 310 RGPPESPLQESLPASPP 260 RG P +P Q P PP Sbjct: 36 RGSPPNPSQGPPPGGPP 52 Score = 21.0 bits (42), Expect = 7.7 Identities = 7/10 (70%), Positives = 9/10 (90%) Frame = -1 Query: 261 RHNLSLPQCY 232 RHNLSL +C+ Sbjct: 553 RHNLSLHKCF 562 >AB267886-1|BAF46356.1| 567|Apis mellifera ecdysteroid receptor A isoform protein. Length = 567 Score = 21.0 bits (42), Expect = 7.7 Identities = 11/22 (50%), Positives = 11/22 (50%) Frame = -1 Query: 111 RPQPATVRANLLGGFTV*SVLG 46 RP P TV A LL T LG Sbjct: 517 RPNPGTVFARLLSVLTELRTLG 538 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 152,869 Number of Sequences: 438 Number of extensions: 3374 Number of successful extensions: 7 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 14722920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -