BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30421 (819 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 24 1.3 AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein pr... 23 2.9 DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc gr... 23 3.9 AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory recept... 22 6.7 AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface pro... 22 6.7 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 24.2 bits (50), Expect = 1.3 Identities = 10/39 (25%), Positives = 19/39 (48%) Frame = +1 Query: 586 WTSPSSRLTWCLTPVSTSHWSRTRQSSLPRRPTMNSFPS 702 W+S ++ W T + +R +S RPT ++P+ Sbjct: 1043 WSSTTTSPWWTTTTTRRTTTTRPTTTSTTTRPTTTNWPT 1081 Score = 22.6 bits (46), Expect = 3.9 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = +1 Query: 625 PVSTSHWSRTRQSSLPRRPT 684 P +T+HW +S RPT Sbjct: 1177 PSTTNHWQTKTTTSTTTRPT 1196 Score = 21.8 bits (44), Expect = 6.7 Identities = 7/11 (63%), Positives = 8/11 (72%) Frame = -3 Query: 484 YGGRCHRWLHC 452 Y G C R+LHC Sbjct: 1287 YPGDCTRYLHC 1297 >AY293621-1|AAP46162.1| 392|Tribolium castaneum glass protein protein. Length = 392 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/27 (33%), Positives = 11/27 (40%) Frame = -2 Query: 218 QRACGFCPKPNLRFPFQWCSDHGHSCW 138 Q C + PN C+D SCW Sbjct: 15 QLECNWSSGPNATLQSSACTDDLSSCW 41 >DQ659254-1|ABG47452.1| 431|Tribolium castaneum imaginal disc growth factor 4 protein. Length = 431 Score = 22.6 bits (46), Expect = 3.9 Identities = 14/30 (46%), Positives = 16/30 (53%) Frame = +2 Query: 143 NYARGHYTIGKEIVDLVLDRIRKLADQCTG 232 +YAR G IVD+ LD R L CTG Sbjct: 392 SYARAKGLGGIAIVDITLDDFRGL---CTG 418 >AM292337-1|CAL23149.2| 452|Tribolium castaneum gustatory receptor candidate 16 protein. Length = 452 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/15 (53%), Positives = 9/15 (60%) Frame = +3 Query: 774 WLAVCCTVVTSYPRM 818 W VC VV YPR+ Sbjct: 166 WREVCTFVVQVYPRL 180 >AF322227-1|AAK01654.1| 782|Tribolium castaneum cell surface protein chaoptin protein. Length = 782 Score = 21.8 bits (44), Expect = 6.7 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -2 Query: 740 LVGGLEACVCDLG 702 L+GG +C CDLG Sbjct: 703 LMGGKWSCDCDLG 715 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,887 Number of Sequences: 336 Number of extensions: 4205 Number of successful extensions: 19 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 22414104 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -