BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30420 (729 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A6DEH3 Cluster: Putative uncharacterized protein; n=1; ... 34 3.1 UniRef50_Q95R15 Cluster: Putative uncharacterized protein; n=1; ... 33 9.5 >UniRef50_A6DEH3 Cluster: Putative uncharacterized protein; n=1; Caminibacter mediatlanticus TB-2|Rep: Putative uncharacterized protein - Caminibacter mediatlanticus TB-2 Length = 960 Score = 34.3 bits (75), Expect = 3.1 Identities = 17/53 (32%), Positives = 28/53 (52%) Frame = -2 Query: 347 DKFRHYYCYHNIIYSYVRLSTASNNVSIQNIYAILNINLGHRACQTICFSNTT 189 D + Y N ++SY +LS+ NN++ NI I N+N + +C +N T Sbjct: 488 DSNNSVFRYQNYLFSYEKLSSIINNLNSNNI--INNLNFSYSNINILCDANIT 538 >UniRef50_Q95R15 Cluster: Putative uncharacterized protein; n=1; Caenorhabditis elegans|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 165 Score = 32.7 bits (71), Expect = 9.5 Identities = 14/49 (28%), Positives = 26/49 (53%) Frame = -2 Query: 215 QTICFSNTTLPLLCQKKHFLFRSDMATLKHLIKILYRLFVLRRFSILYK 69 + I F P C +K+ F +MA L +++ + +L ++FS L+K Sbjct: 91 ELIQFGYEPFPTTCGRKYIFFGEEMAILPNILSYMKQLSKAKKFSTLFK 139 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 637,687,564 Number of Sequences: 1657284 Number of extensions: 11886940 Number of successful extensions: 25923 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 25024 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25916 length of database: 575,637,011 effective HSP length: 99 effective length of database: 411,565,895 effective search space used: 58853922985 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -