BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30420 (729 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_04_0275 - 19650555-19650625,19650927-19651221,19651593-196518... 29 3.8 09_06_0177 + 21365314-21366100,21367451-21367578,21367715-213678... 28 8.7 >05_04_0275 - 19650555-19650625,19650927-19651221,19651593-19651895, 19651978-19652182,19652266-19652501,19652619-19652816, 19653785-19653907,19654227-19654514,19654618-19654794, 19655580-19655915,19656753-19656863,19656977-19657227, 19657431-19657566 Length = 909 Score = 29.1 bits (62), Expect = 3.8 Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 4/59 (6%) Frame = -2 Query: 290 STASNNVSI-QNIYAILNINLGHRACQTICFSN---TTLPLLCQKKHFLFRSDMATLKH 126 +T N S+ N YA NI L A +T+ S T +PL Q+K F + + LKH Sbjct: 701 NTKGNVFSVPSNTYAEFNIFLDPLAAKTVLDSTLDITLIPLRAQRKAASFHALLEALKH 759 >09_06_0177 + 21365314-21366100,21367451-21367578,21367715-21367870, 21368006-21368196,21369392-21369434,21369537-21369627, 21369859-21369935,21370278-21370366,21370474-21370657, 21370885-21371138,21371465-21371567,21371646-21371977, 21372060-21372504 Length = 959 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = -2 Query: 224 RACQTICFSNTTLPLLCQKKHFLFRSDMATLKHLIKILYRLFV 96 R C C+ N LP L +K FL+ L H+ + L + Sbjct: 563 RKCTPKCYLNRVLPALLKKHLFLWLKFRKILSHIAHTTFSLVI 605 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,757,606 Number of Sequences: 37544 Number of extensions: 280418 Number of successful extensions: 519 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 512 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 519 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 1909952136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -