BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdV30420 (729 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 24 1.7 AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cycl... 23 2.9 DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex det... 22 5.2 AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamat... 22 5.2 AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamat... 22 5.2 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 23.8 bits (49), Expect = 1.7 Identities = 14/29 (48%), Positives = 17/29 (58%), Gaps = 1/29 (3%) Frame = +2 Query: 620 HGNQNLISRSTGDIL-NYFRLILPFNENN 703 HGN + R D+L NY RLI P + NN Sbjct: 16 HGNPDA-KRLYDDLLSNYNRLIRPVSNNN 43 >AB193550-1|BAD66824.1| 699|Apis mellifera soluble guanylyl cyclase alpha 1 subunit protein. Length = 699 Score = 23.0 bits (47), Expect = 2.9 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -1 Query: 219 LPNYMFFQHNIATTLPKKTFSLPLR 145 +P Y F HN+ ++ S PLR Sbjct: 601 MPRYCLFGHNVTLANKFESLSEPLR 625 >DQ325090-1|ABD14104.1| 178|Apis mellifera complementary sex determiner protein. Length = 178 Score = 22.2 bits (45), Expect = 5.2 Identities = 9/34 (26%), Positives = 19/34 (55%) Frame = -2 Query: 677 IENNLKYHRLSGLLSFDYRDYRINYMITKKRVRV 576 + NN KY + +++ + Y NY+I +++ V Sbjct: 85 LSNNYKYSNYNNYNNYNKKLYYKNYIINIEQIPV 118 >AY463910-1|AAR24352.1| 843|Apis mellifera metabotropic glutamate receptor 1 protein. Length = 843 Score = 22.2 bits (45), Expect = 5.2 Identities = 5/16 (31%), Positives = 12/16 (75%) Frame = -1 Query: 573 KWFYQNNQSTVIKCNV 526 ++FY + + ++KCN+ Sbjct: 654 RFFYPDRKQVILKCNI 669 >AB161181-1|BAD08343.1| 933|Apis mellifera metabotropic glutamate receptor protein. Length = 933 Score = 22.2 bits (45), Expect = 5.2 Identities = 5/16 (31%), Positives = 12/16 (75%) Frame = -1 Query: 573 KWFYQNNQSTVIKCNV 526 ++FY + + ++KCN+ Sbjct: 744 RFFYPDRKQVILKCNI 759 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 187,265 Number of Sequences: 438 Number of extensions: 4191 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22657590 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -